SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_073570 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_073570
Domain Number 1 Region: 28-344
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.07e-66
Family N-acetyl transferase, NAT 0.0000991
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_073570
Sequence length 405
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=histone acetyltransferase, putative | location=DS571171:56168-57385(+) | length=405
Sequence
MDKELLNEVLAEVMEDPNLMDKDPLANKNKDFICSAQDAIGLYFVSNKEEVEKALKDKYL
ENAVDYPDYVHQLFMGDCEIYGYKDLKVHVLISVYSHQMYVDFSYSQKIDDAEDIIKCLH
KFMPKNQRILSLEGFIEQLEKEKYGFKPCGKKLYEFEQNGEVYEIYYGDVNTMYEYYCQL
FPVITMYIERANCVNPEGKWEFFNLFQVIENPSNVSQIEYRIAAQTNTYRFYHYPDSWRL
RIGQFITFPNYQRKKLGRYLLRQVYSFILSDKDFDLTVEDACLEFQKLRTFVELKMMEEQ
QLKLPIDIQSDTLSECPEDFCEIVRKKCGITKMEIMSLYEMMVWAELKNNNEIMPKLALE
LKRKYYSQTKTELELLESDEMRLEMIERAYKAKIAHFKQIYNVLE
Download sequence
Identical sequences A0A175JJA3 C4LXL7 M2RPQ3 M3TR74 M7XCV3 N9THR1
gi|56470975|gb|EAL48581.1| gi|67476848|ref|XP_653967.1| XP_653967.1.49425 jCVI|EHI_073570 294381.C4LXL7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]