SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_080280 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_080280
Domain Number 1 Region: 13-153
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.37e-21
Family N-acetyl transferase, NAT 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_080280
Sequence length 159
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=glucosamine 6-phosphate N-acetyltransferase. putative | location=DS571380:21607-22148(-) | length=159
Sequence
MNSIYHIKSTLPIINDIRFRCLEREDYHKGVIQVLNELSNCQMDKQKYEKIFDELKETGR
YVIVVGEDEQEKIVCVGTLFIERKFIWNGGLVGHIEDIGVTQSRRNQGIGKGLIDSLLII
GKDEGCCRIILDCKDRVKGFYEKCGMTYKDNCMAIYLNK
Download sequence
Identical sequences A0A175JXE5 C4M8Y3 M2R6G8 M3S9W8 M7WZ83 N9V4W8
gi|56465986|gb|EAL44136.1| gi|67466761|ref|XP_649522.1| jCVI|EHI_080280 XP_649522.1.49425 294381.C4M8Y3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]