SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_137930 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_137930
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.03e-23
Family N-acetyl transferase, NAT 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_137930
Sequence length 174
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=acetyltransferase, GNAT family | location=DS571187:60981-61573(-) | length=174
Sequence
MTTIRKFKCRDILEYSNVNLDYYTETFHFPFYFEYLSKWPEMCFIARDCNGRVEGYHFGK
IEGEGEKYHGHLTAITIAREFRRIGLSNQLMFWLKQISEEANCYYVDLFVRKSNETAIGM
YHRLGYSVYREILEYYSSNNESAYDMRTSLPRDVDKKSIIPLPKPIYADEADDL
Download sequence
Identical sequences A0A175JLE4 C4LZF4 K2GGH2 M2S300 M3UII9 M7W5V5 N9UTY7
jCVI|EHI_137930 XP_008855806.1.50645 XP_654064.2.49425 gi|169802354|gb|EAL48674.2| gi|183231737|ref|XP_654064.2| 294381.C4LZF4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]