SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_152010 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_152010
Domain Number 1 Region: 144-365
Classification Level Classification E-value
Superfamily Radical SAM enzymes 5.36e-31
Family Oxygen-independent coproporphyrinogen III oxidase HemN 0.033
Further Details:      
 
Domain Number 2 Region: 434-553
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000605
Family N-acetyl transferase, NAT 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_152010
Sequence length 576
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=histone acetyltransferase, putative | location=DS571145:189226-190956(+) | length=576
Sequence
MKSNVIRGRKGPAKYGRNSVQFVACINEIVQVMIDLYEKGEEINLNKLKSQMAQKHNLHT
APKQVDIIAAIPDSHRPFLLPIVKSKPVRTASGIVAIAVMCKPHRCPNIRTNGDSCVYCP
GGCDSDFEYSTQSYTGYEPTSMRAVRARYNPYIQSRSRVEQLQKLGHSVEKVEYIIMGGT
FLSMDKHYRDSFILGLFDALSGHVSSTVEEAVHYGENSKVKCVALTIETRPDCCSEDHIR
EMFRYGTTRLEIGLQSIFEDICKECNRGHTVQDCIGCYKRLKDAGYKIVTHMMPNLPGVP
PERDVFTYSEMFSDGAYQCDGLKLYPCLVIRGTRLYEMWRKGHYHSYTSEETIDVLSRIL
ALIPPWVRVHRIQRDIPIPLVSAGADKGNLREYVQRQMDANNWPCRDTRTREVGIAALQG
KPGKKVKCVKDIELIRRDYVGSDGWETFLSYEDPENDLLIGLLRLRLPTNEKFMPELKGK
TSIIRELHVYGTSIPVNTKNLNQFQHMGYGALLIQEAERIAREEHGSDKIVIISGVGVRH
YYRKFGYTLDGPYMAKSLNEDHPQLQDIRRFNDYEN
Download sequence
Identical sequences A0A175JCT4 C4LSP0 M2RPW5 M3TLP9 M7WHH1 N9USU1
294381.C4LSP0 jCVI|EHI_152010 gi|56474633|gb|EAL51995.1| gi|67484318|ref|XP_657379.1| XP_657379.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]