SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_186730 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_186730
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.79e-28
Family N-acetyl transferase, NAT 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_186730
Sequence length 183
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=acetyltransferase, GNAT family | location=DS571159:27979-28780(-) | length=183
Sequence
MFTIRKATPADLPAIQNVNLTNLPENYNLQLYYYHLILYPTSFVAVTPDNKVVGYCLTKI
EDDDPHPVVTGQVTSISVLRTYRRLGIATKLIRAAENSMIEVFGARAMMLQVRVSNQPAL
HLYEKTIGFTVTKVSKHYYLDGEDALILTHNFTLDTLINKDCSSVVVDEWKRVMQEQENK
QKE
Download sequence
Identical sequences A0A175JH40 C4LVP0 M2QBY5 M7X2K9 N9TFX1
jCVI|EHI_186730 XP_649513.1.49425 gi|56465973|gb|EAL44127.1| gi|67466743|ref|XP_649513.1| 294381.C4LVP0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]