SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_197250 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_197250
Domain Number 1 Region: 1-81,117-187
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.83e-19
Family N-acetyl transferase, NAT 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_197250
Sequence length 206
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=acetyltransferase, GNAT family | location=DS571157:86113-86733(+) | length=206
Sequence
MEVKYRLMNQKDWKFIKEMVCQAWETDKYLPEYLVDSYCEEYCSYCYLHSNYCIVAEENE
KVIGFLMGRDQSIFKKNNILEQKVKELKKQFHCYPESSILINSIEKYYEEAEKINQKSNK
SIQNEVVLFIVNKEYRKKGIGKQLLNEFIKILQKTNQHDFYLITDTSCNYHLYDHLNYIQ
INSVFYPFKLSNCVLNITIFIYIHHF
Download sequence
Identical sequences A0A175JG11 C4LVE2 M2RGB3 M3UZR5 M7W774 N9V286
XP_653983.1.49425 jCVI|EHI_197250 294381.C4LVE2 gi|56470994|gb|EAL48597.1| gi|67476892|ref|XP_653983.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]