SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_198550 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_198550
Domain Number 1 Region: 15-152
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.35e-18
Family N-acetyl transferase, NAT 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_198550
Sequence length 158
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=glucosamine 6-phosphate N-acetyltransferase. putative | location=DS571165:857-1380(-) | length=158
Sequence
MTSLFISPIQLPQVGTIQFRALQKEDYDKGVCSVLEQLTSCSTDKNKFNDVFDLMKKENN
YYIVVGEDLSTSQIILTGTLFIESKIIHNGSSVGHIEDIAVSNSYRKMNLGRILIDTLVK
LGQVNSCYKIILDCSSSVLPFYEKCGLSKKGHFMAIYF
Download sequence
Identical sequences A0A175JHH5 C4LWQ1 K2GVS3 M2Q170 M3UIW0 M7W0R4 N9TN29
gi|56472314|gb|EAL49808.1| gi|67479625|ref|XP_655194.1| jCVI|EHI_198550 XP_008858473.1.50645 XP_655194.1.49425 294381.C4LWQ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]