SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15829805|ref|NP_308578.1| from Escherichia coli O157:H7 str. Sakai

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15829805|ref|NP_308578.1|
Domain Number 1 Region: 94-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000719
Family NfeD domain-like 0.0089
Further Details:      
 
Weak hits

Sequence:  gi|15829805|ref|NP_308578.1|
Domain Number - Region: 31-80
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000628
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15829805|ref|NP_308578.1|
Sequence length 151
Comment hypothetical protein ECs0551 [Escherichia coli O157:H7 str. Sakai]
Sequence
MELIVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLVPLGWEWQGVMFA
VLTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSSW
PVSASEDLGAGTHVEVIAIEGITLIIRAVIA
Download sequence
Identical sequences A0A0H3JDV1
gi|15829805|ref|NP_308578.1| 386585.ECs0551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]