SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15829950|ref|NP_308723.1| from Escherichia coli O157:H7 str. Sakai

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15829950|ref|NP_308723.1|
Domain Number 1 Region: 205-279
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.37e-34
Family CorC/HlyC domain-like 0.065
Further Details:      
 
Domain Number 2 Region: 66-202
Classification Level Classification E-value
Superfamily CBS-domain pair 3.77e-32
Family SCOPe 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15829950|ref|NP_308723.1|
Sequence length 292
Comment transporter [Escherichia coli O157:H7 str. Sakai]
Sequence
MSDDNSHSSDTISNKKGFFSLLLSQLFHGEPKNRDELLALIRDSGQNDLIDEDTRDMLEG
VMDIADQRVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFPVISEDKDHIEGILMAK
DLLPFMRSDAEAFSMDKVLRQAVVVPESKRVDRMLKEFRSQRYHMAIVIDEFGGVSGLVT
IEDILELIVGEIEDEYDEEDDIDFRQLSRHTWTVRALASIEDFNEAFGTHFSDEEVDTIG
GLVMQAFGHLPARGETIDIDGYQFKVAMADSRRIIQVHVKIPDDSPQPKLDE
Download sequence
Identical sequences A0A017IKG3 A0A023YU67 A0A024KRF6 A0A025CGK2 A0A026V5D2 A0A027TFA5 A0A028A350 A0A029IC15 A0A029J2J0 A0A062Y3P2 A0A064TYQ5 A0A069XJJ1 A0A070F8U2 A0A070T340 A0A070UQM5 A0A073FZF2 A0A073HPS3 A0A073V4R4 A0A074I9S1 A0A080G6K8 A0A080JEB7 A0A090NZ66 A0A0A0FEG7 A0A0A8U9G0 A0A0E0TW47 A0A0E0V1P4 A0A0E0Y3X5 A0A0E1LUQ6 A0A0E2LN12 A0A0E2TQ70 A0A0F6C0H1 A0A0F6F2L0 A0A0F6MAU6 A0A0G3K6C4 A0A0H2YX32 A0A0H3EEI7 A0A0H3MMT8 A0A0H3PRQ1 A0A0H8WBG3 A0A0K9TD92 A0A0M9J9H8 A0A125X7L9 A0A127GHR2 A0A140NC86 A0A142H0J2 A0A163V4Y0 A0A192CJX3 A0A1E2VKQ2 A0A1E3N2Y5 A0A1Q8MCC1 A0A1S6T8A7 A0A1S9KDN0 A0A1W2N319 A0A1X3I802 A0A1X3IRG9 A0A1X3J572 A0A1X3JKX8 A0A1X3K8M2 A0A1X3KQ76 A0A1X3L6M9 A0A1X3LGH5 A0A1X3LUN6 A0A1X3MEK7 A0A1Z3UTF7 A0A222QGL7 A0A226K7I0 A0A2A9BKT4 A0A2D0NMW7 A0A2H1BMR8 A0A2I8C414 A7ZJ50 B1LLA9 B2TU62 B6I171 B7L9K5 B7LKU6 B7MFS4 B7MPH4 B7N9R3 B7UKU1 C3TJ72 C8U320 C8UJX4 D2A9Y7 D3GXC1 D3QLU8 D6HTN2 D6I6P4 D6J7Y3 D7XEP2 D7XXC0 D7Y994 D7ZJ43 D8A8B9 D8E8Q3 E0J1T7 E1IR90 E1J1G8 E2XA87 E3PGR6 E3XIZ5 E6BKZ1 E7SKW8 E7TJE0 E9TN94 E9XNZ9 E9YRM3 F0JLK3 F4NLQ9 F4SKE3 F4SVH8 F4TBM7 F4UZN5 F4VB84 G0FEE4 H4I836 H4INC6 H4J509 H4KDE1 H4L7X9 H4UFY6 I0VQI7 I2RB90 I2SZC3 I2UM42 I2W509 I2WRE8 I2X7P5 I4SMH4 I6D407 I6ER20 I6G6B8 I6H862 J7QYN7 K0XAA4 K4W371 K4WHU1 L2V907 L2W5J7 L2XVB3 L3BQI8 L3PBR8 L3QET9 L3QT36 L4JE30 L4VZG7 M9GCV0 P0AE78 P0AE79 P0AE80 P0AE81 Q0T6R7 Q1REQ8 Q324N7 Q32IR4 Q3Z4D4 R8XJU8 S0U7J3 S0W870 S0WT47 S0Y0S4 S0ZSM4 S1C9Z6 S1DSA7 S1EV14 S1G5F0 S1HQW3 S1IGZ2 S1J5D4 S1LSJ4 S1PKI9 T5VGI8 T6APF9 T6HZ62 T6MA15 T8KDC4 T9A9D1 T9DY19 T9TEL0 U9XSX4 U9XTC3 U9XVY7 U9ZBS9 U9ZR32 V0SFT6 V0V988 V0XKB3 V0Y7M0 V2RG42 V2V1J1 V6FU49 V8FLE8 V8KIX6 W1B404 W1EW76 W1X7K3 W8ZES8
gi|251784159|ref|YP_002998463.1| gi|82775935|ref|YP_402282.1| gi|260853909|ref|YP_003227800.1| gi|387620401|ref|YP_006128028.1| gi|378713963|ref|YP_005278856.1| gi|387615937|ref|YP_006118959.1| gi|110804694|ref|YP_688214.1| gi|117622867|ref|YP_851780.1| gi|254160737|ref|YP_003043845.1| gi|170682729|ref|YP_001742776.1| gi|187730106|ref|YP_001879333.1| gi|218699022|ref|YP_002406651.1| gi|222155406|ref|YP_002555545.1| gi|218694097|ref|YP_002401764.1| gi|209398266|ref|YP_002269293.1| gi|560155478|ref|YP_008848193.1| gi|253774358|ref|YP_003037189.1| gi|110640880|ref|YP_668608.1| gi|215485691|ref|YP_002328122.1| 354446 APC27344 ASG-ybeX ER40 gi|386633125|ref|YP_006152844.1| gi|170080338|ref|YP_001729658.1| gi|209917920|ref|YP_002292004.1| gi|386628205|ref|YP_006147925.1| gi|386708440|ref|YP_006172161.1| gi|386638030|ref|YP_006104828.1| gi|387828649|ref|YP_003348586.1| gi|30062155|ref|NP_836326.1| gi|82543102|ref|YP_407049.1| gi|387620401|ref|YP_006128028.1| gi|386623043|ref|YP_006142771.1| gi|471332737|ref|YP_007556214.1| gi|254791821|ref|YP_003076658.1| gi|260866806|ref|YP_003233208.1| gi|157160146|ref|YP_001457464.1| gi|386605427|ref|YP_006111727.1| gi|386703840|ref|YP_006167687.1| gi|26246633|ref|NP_752673.1| gi|556550763|ref|YP_008720705.1| gi|407483184|ref|YP_006780333.1| gi|386618113|ref|YP_006137693.1| gi|24112044|ref|NP_706554.1| gi|386598395|ref|YP_006099901.1| gi|91209701|ref|YP_539687.1| gi|15800371|ref|NP_286383.1| gi|387611160|ref|YP_006114276.1| gi|407468085|ref|YP_006785473.1| gi|384542223|ref|YP_005726285.1| gi|218557589|ref|YP_002390502.1| 155864.Z0807 198214.SF0624 198215.S0646 199310.c0743 300267.SDY_0594 300268.SBO_0522 300269.SSON_0612 316385.ECDH10B_0727 316407.ybeX 331111.EcE24377A_0687 331112.EcHS_A0705 344609.SbBS512_E0589 362663.ECP_0681 364106.UTI89_C0656 373384.SFV_0669 386585.ECs0696 405955.APECO1_1405 409438.ECSE_0729 413997.ECB_00626 439855.EcSMS35_0680 444450.ECH74115_0751 469008.ECBD_2993 481805.EcolC_2987 511145.b0658 544404.ECSP_0709 573235.ECO26_0733 574521.E2348C_0551 585034.ECIAI1_0642 585035.ECS88_0693 585054.EFER_2444 585055.EC55989_0653 585056.ECUMN_0751 585057.ECIAI39_0625 585395.ECO103_0665 585396.ECO111_0688 585397.ECED1_0649 595496.BWG_0529 gi|387606158|ref|YP_006095014.1| gi|386612836|ref|YP_006132502.1| gi|74311194|ref|YP_309613.1| gi|544389449|ref|YP_008563848.1| gi|15829950|ref|NP_308723.1| gi|410483737|ref|YP_006771283.1| gi|157154891|ref|YP_001461829.1| gi|218688475|ref|YP_002396687.1| gi|378713963|ref|YP_005278856.1| gi|383177232|ref|YP_005455237.1| NP_308723.1.58667 NP_415191.1.90541 NP_706554.1.23235 WP_001278605.1.1000 WP_001278605.1.10001 WP_001278605.1.100014 WP_001278605.1.100044 WP_001278605.1.100052 WP_001278605.1.100063 WP_001278605.1.100066 WP_001278605.1.100073 WP_001278605.1.100085 WP_001278605.1.10010 WP_001278605.1.100111 WP_001278605.1.100116 WP_001278605.1.100135 WP_001278605.1.100138 WP_001278605.1.100151 WP_001278605.1.100159 WP_001278605.1.100185 WP_001278605.1.100194 WP_001278605.1.100220 WP_001278605.1.100227 WP_001278605.1.100251 WP_001278605.1.100252 WP_001278605.1.100281 WP_001278605.1.100283 WP_001278605.1.100285 WP_001278605.1.100299 WP_001278605.1.100302 WP_001278605.1.100304 WP_001278605.1.100306 WP_001278605.1.100315 WP_001278605.1.10034 WP_001278605.1.100346 WP_001278605.1.100389 WP_001278605.1.100425 WP_001278605.1.100441 WP_001278605.1.100444 WP_001278605.1.100447 WP_001278605.1.100448 WP_001278605.1.100451 WP_001278605.1.100474 WP_001278605.1.10048 WP_001278605.1.100487 WP_001278605.1.100496 WP_001278605.1.100499 WP_001278605.1.100508 WP_001278605.1.10051 WP_001278605.1.100531 WP_001278605.1.100543 WP_001278605.1.100554 WP_001278605.1.100571 WP_001278605.1.100573 WP_001278605.1.100614 WP_001278605.1.100667 WP_001278605.1.10067 WP_001278605.1.10068 WP_001278605.1.100685 WP_001278605.1.100688 WP_001278605.1.100689 WP_001278605.1.100718 WP_001278605.1.100725 WP_001278605.1.100735 WP_001278605.1.100738 WP_001278605.1.100752 WP_001278605.1.100758 WP_001278605.1.100796 WP_001278605.1.10080 WP_001278605.1.100803 WP_001278605.1.100824 WP_001278605.1.100851 WP_001278605.1.100852 WP_001278605.1.10086 WP_001278605.1.100867 WP_001278605.1.100868 WP_001278605.1.100898 WP_001278605.1.100916 WP_001278605.1.100925 WP_001278605.1.100928 WP_001278605.1.100933 WP_001278605.1.10094 WP_001278605.1.100950 WP_001278605.1.100959 WP_001278605.1.100966 WP_001278605.1.100990 WP_001278605.1.10100 WP_001278605.1.101033 WP_001278605.1.101052 WP_001278605.1.101087 WP_001278605.1.101096 WP_001278605.1.1011 WP_001278605.1.101102 WP_001278605.1.101105 WP_001278605.1.101110 WP_001278605.1.101121 WP_001278605.1.101148 WP_001278605.1.101152 WP_001278605.1.101157 WP_001278605.1.101158 WP_001278605.1.101166 WP_001278605.1.101175 WP_001278605.1.101186 WP_001278605.1.101206 WP_001278605.1.101214 WP_001278605.1.101216 WP_001278605.1.101255 WP_001278605.1.101257 WP_001278605.1.10126 WP_001278605.1.101282 WP_001278605.1.101289 WP_001278605.1.101293 WP_001278605.1.10131 WP_001278605.1.101313 WP_001278605.1.101359 WP_001278605.1.10138 WP_001278605.1.101387 WP_001278605.1.101399 WP_001278605.1.101418 WP_001278605.1.101423 WP_001278605.1.101429 WP_001278605.1.101430 WP_001278605.1.101436 WP_001278605.1.101439 WP_001278605.1.101445 WP_001278605.1.101468 WP_001278605.1.101486 WP_001278605.1.101518 WP_001278605.1.101522 WP_001278605.1.10154 WP_001278605.1.101545 WP_001278605.1.101583 WP_001278605.1.101586 WP_001278605.1.101594 WP_001278605.1.101628 WP_001278605.1.101630 WP_001278605.1.101651 WP_001278605.1.101653 WP_001278605.1.101654 WP_001278605.1.101667 WP_001278605.1.101668 WP_001278605.1.101686 WP_001278605.1.101693 WP_001278605.1.101694 WP_001278605.1.101700 WP_001278605.1.101727 WP_001278605.1.10173 WP_001278605.1.101737 WP_001278605.1.101747 WP_001278605.1.101769 WP_001278605.1.101777 WP_001278605.1.101786 WP_001278605.1.10181 WP_001278605.1.101822 WP_001278605.1.10184 WP_001278605.1.101840 WP_001278605.1.101845 WP_001278605.1.101855 WP_001278605.1.101865 WP_001278605.1.10187 WP_001278605.1.10188 WP_001278605.1.101887 WP_001278605.1.101889 WP_001278605.1.10190 WP_001278605.1.101900 WP_001278605.1.101908 WP_001278605.1.101913 WP_001278605.1.101926 WP_001278605.1.101932 WP_001278605.1.101935 WP_001278605.1.101937 WP_001278605.1.101940 WP_001278605.1.101942 WP_001278605.1.101947 WP_001278605.1.101948 WP_001278605.1.101952 WP_001278605.1.101962 WP_001278605.1.101964 WP_001278605.1.101969 WP_001278605.1.101977 WP_001278605.1.101984 WP_001278605.1.101987 WP_001278605.1.102021 WP_001278605.1.102036 WP_001278605.1.10206 WP_001278605.1.102069 WP_001278605.1.102076 WP_001278605.1.102093 WP_001278605.1.102094 WP_001278605.1.102104 WP_001278605.1.102106 WP_001278605.1.102122 WP_001278605.1.102139 WP_001278605.1.102144 WP_001278605.1.10222 WP_001278605.1.10226 WP_001278605.1.10233 WP_001278605.1.10235 WP_001278605.1.10252 WP_001278605.1.10273 WP_001278605.1.10304 WP_001278605.1.10326 WP_001278605.1.10329 WP_001278605.1.10335 WP_001278605.1.10348 WP_001278605.1.10352 WP_001278605.1.10361 WP_001278605.1.10379 WP_001278605.1.10381 WP_001278605.1.1040 WP_001278605.1.10400 WP_001278605.1.10417 WP_001278605.1.10461 WP_001278605.1.10476 WP_001278605.1.10491 WP_001278605.1.10492 WP_001278605.1.10496 WP_001278605.1.10508 WP_001278605.1.10524 WP_001278605.1.10525 WP_001278605.1.10538 WP_001278605.1.10569 WP_001278605.1.10573 WP_001278605.1.10576 WP_001278605.1.10579 WP_001278605.1.1058 WP_001278605.1.10605 WP_001278605.1.10607 WP_001278605.1.10628 WP_001278605.1.10651 WP_001278605.1.10673 WP_001278605.1.10697 WP_001278605.1.10705 WP_001278605.1.1071 WP_001278605.1.10715 WP_001278605.1.10729 WP_001278605.1.1073 WP_001278605.1.1074 WP_001278605.1.10744 WP_001278605.1.10748 WP_001278605.1.10761 WP_001278605.1.10763 WP_001278605.1.10771 WP_001278605.1.10786 WP_001278605.1.10787 WP_001278605.1.10798 WP_001278605.1.10809 WP_001278605.1.10814 WP_001278605.1.10824 WP_001278605.1.10833 WP_001278605.1.10842 WP_001278605.1.10849 WP_001278605.1.10862 WP_001278605.1.10869 WP_001278605.1.10922 WP_001278605.1.10940 WP_001278605.1.10970 WP_001278605.1.10988 WP_001278605.1.10989 WP_001278605.1.10994 WP_001278605.1.10995 WP_001278605.1.11006 WP_001278605.1.11047 WP_001278605.1.11052 WP_001278605.1.11057 WP_001278605.1.11068 WP_001278605.1.11071 WP_001278605.1.11091 WP_001278605.1.1111 WP_001278605.1.11113 WP_001278605.1.11118 WP_001278605.1.11121 WP_001278605.1.1113 WP_001278605.1.11133 WP_001278605.1.112 WP_001278605.1.11217 WP_001278605.1.1122 WP_001278605.1.11240 WP_001278605.1.11241 WP_001278605.1.11250 WP_001278605.1.11251 WP_001278605.1.11265 WP_001278605.1.11272 WP_001278605.1.11285 WP_001278605.1.11296 WP_001278605.1.11301 WP_001278605.1.11315 WP_001278605.1.11323 WP_001278605.1.11399 WP_001278605.1.11408 WP_001278605.1.11411 WP_001278605.1.11418 WP_001278605.1.11420 WP_001278605.1.11436 WP_001278605.1.11437 WP_001278605.1.11440 WP_001278605.1.11452 WP_001278605.1.11467 WP_001278605.1.11499 WP_001278605.1.11519 WP_001278605.1.11524 WP_001278605.1.11531 WP_001278605.1.11542 WP_001278605.1.11575 WP_001278605.1.11578 WP_001278605.1.11595 WP_001278605.1.11607 WP_001278605.1.11608 WP_001278605.1.11612 WP_001278605.1.11616 WP_001278605.1.11645 WP_001278605.1.11671 WP_001278605.1.11673 WP_001278605.1.1168 WP_001278605.1.11690 WP_001278605.1.11699 WP_001278605.1.11748 WP_001278605.1.11759 WP_001278605.1.1176 WP_001278605.1.11762 WP_001278605.1.11801 WP_001278605.1.11803 WP_001278605.1.11844 WP_001278605.1.1186 WP_001278605.1.11912 WP_001278605.1.11948 WP_001278605.1.11949 WP_001278605.1.11955 WP_001278605.1.11956 WP_001278605.1.1196 WP_001278605.1.11981 WP_001278605.1.11982 WP_001278605.1.11985 WP_001278605.1.12000 WP_001278605.1.12009 WP_001278605.1.12010 WP_001278605.1.12030 WP_001278605.1.12036 WP_001278605.1.12050 WP_001278605.1.12051 WP_001278605.1.12060 WP_001278605.1.12076 WP_001278605.1.12088 WP_001278605.1.12095 WP_001278605.1.12111 WP_001278605.1.12112 WP_001278605.1.12115 WP_001278605.1.1212 WP_001278605.1.12151 WP_001278605.1.12157 WP_001278605.1.12174 WP_001278605.1.1218 WP_001278605.1.12204 WP_001278605.1.12230 WP_001278605.1.12259 WP_001278605.1.12268 WP_001278605.1.12279 WP_001278605.1.12292 WP_001278605.1.12295 WP_001278605.1.12305 WP_001278605.1.12319 WP_001278605.1.12320 WP_001278605.1.12342 WP_001278605.1.12344 WP_001278605.1.12352 WP_001278605.1.12415 WP_001278605.1.1242 WP_001278605.1.12426 WP_001278605.1.12458 WP_001278605.1.12459 WP_001278605.1.12468 WP_001278605.1.12478 WP_001278605.1.12542 WP_001278605.1.12552 WP_001278605.1.12558 WP_001278605.1.12566 WP_001278605.1.12574 WP_001278605.1.12582 WP_001278605.1.12594 WP_001278605.1.12623 WP_001278605.1.12645 WP_001278605.1.12646 WP_001278605.1.12675 WP_001278605.1.12679 WP_001278605.1.12680 WP_001278605.1.12693 WP_001278605.1.12697 WP_001278605.1.127 WP_001278605.1.12709 WP_001278605.1.12717 WP_001278605.1.12743 WP_001278605.1.12749 WP_001278605.1.12756 WP_001278605.1.12761 WP_001278605.1.12763 WP_001278605.1.12766 WP_001278605.1.12775 WP_001278605.1.1278 WP_001278605.1.12781 WP_001278605.1.1280 WP_001278605.1.12826 WP_001278605.1.12830 WP_001278605.1.12831 WP_001278605.1.12876 WP_001278605.1.12893 WP_001278605.1.12911 WP_001278605.1.12914 WP_001278605.1.12915 WP_001278605.1.12917 WP_001278605.1.12944 WP_001278605.1.1295 WP_001278605.1.12956 WP_001278605.1.12965 WP_001278605.1.12976 WP_001278605.1.12979 WP_001278605.1.12987 WP_001278605.1.12991 WP_001278605.1.13002 WP_001278605.1.13015 WP_001278605.1.13031 WP_001278605.1.13060 WP_001278605.1.13074 WP_001278605.1.1308 WP_001278605.1.13117 WP_001278605.1.1312 WP_001278605.1.13136 WP_001278605.1.1314 WP_001278605.1.13144 WP_001278605.1.1315 WP_001278605.1.13157 WP_001278605.1.13162 WP_001278605.1.13176 WP_001278605.1.13181 WP_001278605.1.13205 WP_001278605.1.13217 WP_001278605.1.13222 WP_001278605.1.13223 WP_001278605.1.1323 WP_001278605.1.13239 WP_001278605.1.13252 WP_001278605.1.13258 WP_001278605.1.13271 WP_001278605.1.13272 WP_001278605.1.13278 WP_001278605.1.13281 WP_001278605.1.13290 WP_001278605.1.13295 WP_001278605.1.13301 WP_001278605.1.13332 WP_001278605.1.13333 WP_001278605.1.13346 WP_001278605.1.13348 WP_001278605.1.1335 WP_001278605.1.13383 WP_001278605.1.13393 WP_001278605.1.13409 WP_001278605.1.13411 WP_001278605.1.1343 WP_001278605.1.13430 WP_001278605.1.13437 WP_001278605.1.13442 WP_001278605.1.1345 WP_001278605.1.13451 WP_001278605.1.13469 WP_001278605.1.13473 WP_001278605.1.13481 WP_001278605.1.13492 WP_001278605.1.13525 WP_001278605.1.13566 WP_001278605.1.13585 WP_001278605.1.13589 WP_001278605.1.13600 WP_001278605.1.13601 WP_001278605.1.13608 WP_001278605.1.13618 WP_001278605.1.13624 WP_001278605.1.13626 WP_001278605.1.13644 WP_001278605.1.13656 WP_001278605.1.13662 WP_001278605.1.13664 WP_001278605.1.13672 WP_001278605.1.13740 WP_001278605.1.13778 WP_001278605.1.13791 WP_001278605.1.13798 WP_001278605.1.13824 WP_001278605.1.13867 WP_001278605.1.13877 WP_001278605.1.13881 WP_001278605.1.13891 WP_001278605.1.13924 WP_001278605.1.13934 WP_001278605.1.13936 WP_001278605.1.13939 WP_001278605.1.13944 WP_001278605.1.13949 WP_001278605.1.13974 WP_001278605.1.13979 WP_001278605.1.13981 WP_001278605.1.14023 WP_001278605.1.14030 WP_001278605.1.14042 WP_001278605.1.14058 WP_001278605.1.14062 WP_001278605.1.14070 WP_001278605.1.14094 WP_001278605.1.14110 WP_001278605.1.14127 WP_001278605.1.14129 WP_001278605.1.14144 WP_001278605.1.14154 WP_001278605.1.14164 WP_001278605.1.1419 WP_001278605.1.14199 WP_001278605.1.142 WP_001278605.1.14245 WP_001278605.1.14253 WP_001278605.1.14277 WP_001278605.1.14292 WP_001278605.1.14299 WP_001278605.1.14304 WP_001278605.1.14322 WP_001278605.1.14331 WP_001278605.1.14346 WP_001278605.1.14371 WP_001278605.1.1438 WP_001278605.1.14389 WP_001278605.1.1439 WP_001278605.1.14398 WP_001278605.1.14417 WP_001278605.1.14432 WP_001278605.1.14445 WP_001278605.1.14451 WP_001278605.1.14453 WP_001278605.1.14468 WP_001278605.1.14493 WP_001278605.1.14499 WP_001278605.1.14501 WP_001278605.1.14506 WP_001278605.1.14508 WP_001278605.1.14509 WP_001278605.1.14529 WP_001278605.1.14536 WP_001278605.1.14538 WP_001278605.1.14581 WP_001278605.1.14582 WP_001278605.1.14600 WP_001278605.1.14601 WP_001278605.1.14605 WP_001278605.1.14607 WP_001278605.1.1461 WP_001278605.1.14616 WP_001278605.1.14621 WP_001278605.1.14648 WP_001278605.1.14661 WP_001278605.1.14672 WP_001278605.1.14678 WP_001278605.1.14687 WP_001278605.1.14693 WP_001278605.1.1470 WP_001278605.1.14711 WP_001278605.1.14712 WP_001278605.1.14746 WP_001278605.1.14748 WP_001278605.1.14749 WP_001278605.1.14807 WP_001278605.1.14811 WP_001278605.1.14833 WP_001278605.1.1486 WP_001278605.1.14861 WP_001278605.1.14871 WP_001278605.1.14879 WP_001278605.1.14914 WP_001278605.1.14934 WP_001278605.1.14935 WP_001278605.1.14946 WP_001278605.1.14956 WP_001278605.1.14958 WP_001278605.1.14963 WP_001278605.1.14965 WP_001278605.1.14977 WP_001278605.1.14992 WP_001278605.1.14993 WP_001278605.1.15007 WP_001278605.1.15020 WP_001278605.1.15041 WP_001278605.1.1508 WP_001278605.1.15087 WP_001278605.1.15090 WP_001278605.1.1510 WP_001278605.1.15117 WP_001278605.1.1512 WP_001278605.1.15121 WP_001278605.1.15138 WP_001278605.1.15148 WP_001278605.1.15177 WP_001278605.1.15191 WP_001278605.1.15193 WP_001278605.1.15207 WP_001278605.1.15221 WP_001278605.1.1524 WP_001278605.1.15245 WP_001278605.1.15252 WP_001278605.1.15259 WP_001278605.1.15270 WP_001278605.1.15274 WP_001278605.1.15277 WP_001278605.1.15282 WP_001278605.1.15287 WP_001278605.1.15290 WP_001278605.1.15300 WP_001278605.1.15304 WP_001278605.1.15332 WP_001278605.1.15335 WP_001278605.1.15347 WP_001278605.1.15356 WP_001278605.1.15377 WP_001278605.1.15416 WP_001278605.1.15420 WP_001278605.1.1543 WP_001278605.1.15444 WP_001278605.1.15453 WP_001278605.1.15464 WP_001278605.1.15469 WP_001278605.1.15496 WP_001278605.1.1550 WP_001278605.1.15503 WP_001278605.1.15521 WP_001278605.1.15527 WP_001278605.1.15528 WP_001278605.1.15538 WP_001278605.1.15565 WP_001278605.1.15576 WP_001278605.1.15583 WP_001278605.1.1559 WP_001278605.1.15593 WP_001278605.1.15600 WP_001278605.1.1561 WP_001278605.1.15620 WP_001278605.1.15624 WP_001278605.1.15626 WP_001278605.1.15645 WP_001278605.1.15654 WP_001278605.1.15702 WP_001278605.1.15707 WP_001278605.1.15731 WP_001278605.1.15740 WP_001278605.1.15747 WP_001278605.1.15752 WP_001278605.1.15762 WP_001278605.1.15767 WP_001278605.1.15768 WP_001278605.1.15771 WP_001278605.1.15782 WP_001278605.1.15791 WP_001278605.1.1580 WP_001278605.1.15809 WP_001278605.1.1582 WP_001278605.1.15855 WP_001278605.1.15857 WP_001278605.1.15863 WP_001278605.1.15869 WP_001278605.1.1588 WP_001278605.1.15894 WP_001278605.1.15906 WP_001278605.1.15916 WP_001278605.1.15945 WP_001278605.1.15949 WP_001278605.1.15951 WP_001278605.1.15983 WP_001278605.1.15984 WP_001278605.1.15990 WP_001278605.1.16010 WP_001278605.1.16014 WP_001278605.1.16015 WP_001278605.1.16034 WP_001278605.1.1604 WP_001278605.1.16042 WP_001278605.1.16067 WP_001278605.1.16075 WP_001278605.1.16086 WP_001278605.1.16087 WP_001278605.1.1609 WP_001278605.1.16102 WP_001278605.1.16111 WP_001278605.1.16117 WP_001278605.1.16131 WP_001278605.1.16133 WP_001278605.1.16154 WP_001278605.1.16171 WP_001278605.1.16179 WP_001278605.1.16183 WP_001278605.1.16188 WP_001278605.1.16194 WP_001278605.1.1621 WP_001278605.1.1622 WP_001278605.1.16222 WP_001278605.1.16270 WP_001278605.1.16272 WP_001278605.1.16294 WP_001278605.1.163 WP_001278605.1.16303 WP_001278605.1.16322 WP_001278605.1.1634 WP_001278605.1.16387 WP_001278605.1.16388 WP_001278605.1.16396 WP_001278605.1.16435 WP_001278605.1.16463 WP_001278605.1.16481 WP_001278605.1.16482 WP_001278605.1.16500 WP_001278605.1.16517 WP_001278605.1.16532 WP_001278605.1.16539 WP_001278605.1.16541 WP_001278605.1.1655 WP_001278605.1.16577 WP_001278605.1.16592 WP_001278605.1.16604 WP_001278605.1.16608 WP_001278605.1.16612 WP_001278605.1.16640 WP_001278605.1.16648 WP_001278605.1.16667 WP_001278605.1.16669 WP_001278605.1.16682 WP_001278605.1.16685 WP_001278605.1.16705 WP_001278605.1.16715 WP_001278605.1.16721 WP_001278605.1.1673 WP_001278605.1.16745 WP_001278605.1.16752 WP_001278605.1.16766 WP_001278605.1.16780 WP_001278605.1.16798 WP_001278605.1.16799 WP_001278605.1.16805 WP_001278605.1.16807 WP_001278605.1.16818 WP_001278605.1.16843 WP_001278605.1.16845 WP_001278605.1.16861 WP_001278605.1.16862 WP_001278605.1.16894 WP_001278605.1.16927 WP_001278605.1.16970 WP_001278605.1.16979 WP_001278605.1.16992 WP_001278605.1.17014 WP_001278605.1.17017 WP_001278605.1.17018 WP_001278605.1.17028 WP_001278605.1.17042 WP_001278605.1.17061 WP_001278605.1.17084 WP_001278605.1.17085 WP_001278605.1.17087 WP_001278605.1.17089 WP_001278605.1.1710 WP_001278605.1.17101 WP_001278605.1.17102 WP_001278605.1.17109 WP_001278605.1.17111 WP_001278605.1.17114 WP_001278605.1.17119 WP_001278605.1.17123 WP_001278605.1.17150 WP_001278605.1.17153 WP_001278605.1.17170 WP_001278605.1.17172 WP_001278605.1.17182 WP_001278605.1.17186 WP_001278605.1.17187 WP_001278605.1.17205 WP_001278605.1.17206 WP_001278605.1.17230 WP_001278605.1.17241 WP_001278605.1.17242 WP_001278605.1.1726 WP_001278605.1.17267 WP_001278605.1.17282 WP_001278605.1.17290 WP_001278605.1.17297 WP_001278605.1.17300 WP_001278605.1.17301 WP_001278605.1.1731 WP_001278605.1.17325 WP_001278605.1.17333 WP_001278605.1.17356 WP_001278605.1.17360 WP_001278605.1.17373 WP_001278605.1.17386 WP_001278605.1.17387 WP_001278605.1.17389 WP_001278605.1.17392 WP_001278605.1.17403 WP_001278605.1.17410 WP_001278605.1.17415 WP_001278605.1.17417 WP_001278605.1.17432 WP_001278605.1.17441 WP_001278605.1.17461 WP_001278605.1.17464 WP_001278605.1.17496 WP_001278605.1.17515 WP_001278605.1.17534 WP_001278605.1.1755 WP_001278605.1.17550 WP_001278605.1.17568 WP_001278605.1.17570 WP_001278605.1.17577 WP_001278605.1.17584 WP_001278605.1.17595 WP_001278605.1.17623 WP_001278605.1.1763 WP_001278605.1.17637 WP_001278605.1.1766 WP_001278605.1.17680 WP_001278605.1.1769 WP_001278605.1.17701 WP_001278605.1.17711 WP_001278605.1.1772 WP_001278605.1.17734 WP_001278605.1.17757 WP_001278605.1.17765 WP_001278605.1.17766 WP_001278605.1.17769 WP_001278605.1.1778 WP_001278605.1.17802 WP_001278605.1.17829 WP_001278605.1.17831 WP_001278605.1.17836 WP_001278605.1.17849 WP_001278605.1.17889 WP_001278605.1.17904 WP_001278605.1.17920 WP_001278605.1.17925 WP_001278605.1.17937 WP_001278605.1.17952 WP_001278605.1.17961 WP_001278605.1.17963 WP_001278605.1.17984 WP_001278605.1.18000 WP_001278605.1.18006 WP_001278605.1.1802 WP_001278605.1.18024 WP_001278605.1.18050 WP_001278605.1.18064 WP_001278605.1.18094 WP_001278605.1.18112 WP_001278605.1.18118 WP_001278605.1.18121 WP_001278605.1.18133 WP_001278605.1.18134 WP_001278605.1.18136 WP_001278605.1.18164 WP_001278605.1.18175 WP_001278605.1.1821 WP_001278605.1.18225 WP_001278605.1.18226 WP_001278605.1.18229 WP_001278605.1.18275 WP_001278605.1.18311 WP_001278605.1.18316 WP_001278605.1.18326 WP_001278605.1.18329 WP_001278605.1.18337 WP_001278605.1.18338 WP_001278605.1.1834 WP_001278605.1.18340 WP_001278605.1.18348 WP_001278605.1.18354 WP_001278605.1.18381 WP_001278605.1.18383 WP_001278605.1.18394 WP_001278605.1.18402 WP_001278605.1.18410 WP_001278605.1.18420 WP_001278605.1.18436 WP_001278605.1.18438 WP_001278605.1.1844 WP_001278605.1.18458 WP_001278605.1.18461 WP_001278605.1.18472 WP_001278605.1.18482 WP_001278605.1.18511 WP_001278605.1.18519 WP_001278605.1.18530 WP_001278605.1.18550 WP_001278605.1.18556 WP_001278605.1.18581 WP_001278605.1.18583 WP_001278605.1.18588 WP_001278605.1.1861 WP_001278605.1.18617 WP_001278605.1.1862 WP_001278605.1.18628 WP_001278605.1.18649 WP_001278605.1.18650 WP_001278605.1.18651 WP_001278605.1.18655 WP_001278605.1.1866 WP_001278605.1.18666 WP_001278605.1.1867 WP_001278605.1.18675 WP_001278605.1.18699 WP_001278605.1.18714 WP_001278605.1.18725 WP_001278605.1.18726 WP_001278605.1.1873 WP_001278605.1.18794 WP_001278605.1.188 WP_001278605.1.18801 WP_001278605.1.18802 WP_001278605.1.18806 WP_001278605.1.1881 WP_001278605.1.18828 WP_001278605.1.18837 WP_001278605.1.18843 WP_001278605.1.18858 WP_001278605.1.18861 WP_001278605.1.18874 WP_001278605.1.18876 WP_001278605.1.18899 WP_001278605.1.18908 WP_001278605.1.18923 WP_001278605.1.18929 WP_001278605.1.18934 WP_001278605.1.18936 WP_001278605.1.1896 WP_001278605.1.18962 WP_001278605.1.18966 WP_001278605.1.18983 WP_001278605.1.18995 WP_001278605.1.19024 WP_001278605.1.1903 WP_001278605.1.19036 WP_001278605.1.19039 WP_001278605.1.1906 WP_001278605.1.19075 WP_001278605.1.1909 WP_001278605.1.19090 WP_001278605.1.191 WP_001278605.1.19100 WP_001278605.1.19113 WP_001278605.1.19114 WP_001278605.1.19122 WP_001278605.1.19129 WP_001278605.1.19135 WP_001278605.1.19140 WP_001278605.1.19146 WP_001278605.1.19147 WP_001278605.1.19148 WP_001278605.1.1915 WP_001278605.1.19150 WP_001278605.1.19153 WP_001278605.1.19171 WP_001278605.1.19194 WP_001278605.1.19205 WP_001278605.1.19206 WP_001278605.1.19245 WP_001278605.1.1925 WP_001278605.1.19276 WP_001278605.1.19277 WP_001278605.1.19297 WP_001278605.1.193 WP_001278605.1.19312 WP_001278605.1.19313 WP_001278605.1.19314 WP_001278605.1.19315 WP_001278605.1.19332 WP_001278605.1.19338 WP_001278605.1.19347 WP_001278605.1.19350 WP_001278605.1.19361 WP_001278605.1.19374 WP_001278605.1.19379 WP_001278605.1.19389 WP_001278605.1.19397 WP_001278605.1.19419 WP_001278605.1.19424 WP_001278605.1.19441 WP_001278605.1.19448 WP_001278605.1.19453 WP_001278605.1.19465 WP_001278605.1.19478 WP_001278605.1.19487 WP_001278605.1.19494 WP_001278605.1.1952 WP_001278605.1.19534 WP_001278605.1.19544 WP_001278605.1.19547 WP_001278605.1.19557 WP_001278605.1.19581 WP_001278605.1.19583 WP_001278605.1.19593 WP_001278605.1.1960 WP_001278605.1.19602 WP_001278605.1.19612 WP_001278605.1.1963 WP_001278605.1.19644 WP_001278605.1.19649 WP_001278605.1.19651 WP_001278605.1.19654 WP_001278605.1.19655 WP_001278605.1.19661 WP_001278605.1.19684 WP_001278605.1.19691 WP_001278605.1.19758 WP_001278605.1.19760 WP_001278605.1.19761 WP_001278605.1.19778 WP_001278605.1.19795 WP_001278605.1.1982 WP_001278605.1.19830 WP_001278605.1.19838 WP_001278605.1.19840 WP_001278605.1.19845 WP_001278605.1.19847 WP_001278605.1.19861 WP_001278605.1.1987 WP_001278605.1.19873 WP_001278605.1.19878 WP_001278605.1.19889 WP_001278605.1.19940 WP_001278605.1.19945 WP_001278605.1.19957 WP_001278605.1.19972 WP_001278605.1.19994 WP_001278605.1.20025 WP_001278605.1.2005 WP_001278605.1.20096 WP_001278605.1.20114 WP_001278605.1.20115 WP_001278605.1.20129 WP_001278605.1.20133 WP_001278605.1.20136 WP_001278605.1.2015 WP_001278605.1.20151 WP_001278605.1.20157 WP_001278605.1.20159 WP_001278605.1.20164 WP_001278605.1.20166 WP_001278605.1.20170 WP_001278605.1.20178 WP_001278605.1.20183 WP_001278605.1.20192 WP_001278605.1.20215 WP_001278605.1.2022 WP_001278605.1.20224 WP_001278605.1.20230 WP_001278605.1.20238 WP_001278605.1.20251 WP_001278605.1.20264 WP_001278605.1.2027 WP_001278605.1.20277 WP_001278605.1.20289 WP_001278605.1.20290 WP_001278605.1.20308 WP_001278605.1.20318 WP_001278605.1.20325 WP_001278605.1.20331 WP_001278605.1.20334 WP_001278605.1.20370 WP_001278605.1.20388 WP_001278605.1.20445 WP_001278605.1.20449 WP_001278605.1.20452 WP_001278605.1.20480 WP_001278605.1.20483 WP_001278605.1.20484 WP_001278605.1.20493 WP_001278605.1.20506 WP_001278605.1.20519 WP_001278605.1.20536 WP_001278605.1.20546 WP_001278605.1.20549 WP_001278605.1.20565 WP_001278605.1.20575 WP_001278605.1.20594 WP_001278605.1.20596 WP_001278605.1.20609 WP_001278605.1.2063 WP_001278605.1.20636 WP_001278605.1.20638 WP_001278605.1.20640 WP_001278605.1.20662 WP_001278605.1.20668 WP_001278605.1.20691 WP_001278605.1.20709 WP_001278605.1.20724 WP_001278605.1.20730 WP_001278605.1.20737 WP_001278605.1.20741 WP_001278605.1.20745 WP_001278605.1.2075 WP_001278605.1.20761 WP_001278605.1.20765 WP_001278605.1.20784 WP_001278605.1.20785 WP_001278605.1.20803 WP_001278605.1.20813 WP_001278605.1.20818 WP_001278605.1.20824 WP_001278605.1.20831 WP_001278605.1.20841 WP_001278605.1.20848 WP_001278605.1.20863 WP_001278605.1.2089 WP_001278605.1.20893 WP_001278605.1.20907 WP_001278605.1.2092 WP_001278605.1.2093 WP_001278605.1.20933 WP_001278605.1.2094 WP_001278605.1.20941 WP_001278605.1.20943 WP_001278605.1.20950 WP_001278605.1.20958 WP_001278605.1.20962 WP_001278605.1.20982 WP_001278605.1.20989 WP_001278605.1.2100 WP_001278605.1.21017 WP_001278605.1.21020 WP_001278605.1.21022 WP_001278605.1.21024 WP_001278605.1.21029 WP_001278605.1.21033 WP_001278605.1.21041 WP_001278605.1.21057 WP_001278605.1.21059 WP_001278605.1.21104 WP_001278605.1.21122 WP_001278605.1.21129 WP_001278605.1.2113 WP_001278605.1.21131 WP_001278605.1.21137 WP_001278605.1.21152 WP_001278605.1.21197 WP_001278605.1.21236 WP_001278605.1.21251 WP_001278605.1.21255 WP_001278605.1.21266 WP_001278605.1.21277 WP_001278605.1.21305 WP_001278605.1.21320 WP_001278605.1.21336 WP_001278605.1.21378 WP_001278605.1.2142 WP_001278605.1.21441 WP_001278605.1.21450 WP_001278605.1.21455 WP_001278605.1.21470 WP_001278605.1.21508 WP_001278605.1.21519 WP_001278605.1.21526 WP_001278605.1.21537 WP_001278605.1.2156 WP_001278605.1.21573 WP_001278605.1.21578 WP_001278605.1.21596 WP_001278605.1.21614 WP_001278605.1.21628 WP_001278605.1.21634 WP_001278605.1.21637 WP_001278605.1.2164 WP_001278605.1.21652 WP_001278605.1.21656 WP_001278605.1.21661 WP_001278605.1.21666 WP_001278605.1.21667 WP_001278605.1.21668 WP_001278605.1.21673 WP_001278605.1.21714 WP_001278605.1.21727 WP_001278605.1.21729 WP_001278605.1.21732 WP_001278605.1.21733 WP_001278605.1.21756 WP_001278605.1.21758 WP_001278605.1.21762 WP_001278605.1.21771 WP_001278605.1.21773 WP_001278605.1.21811 WP_001278605.1.21812 WP_001278605.1.21823 WP_001278605.1.21887 WP_001278605.1.21895 WP_001278605.1.21899 WP_001278605.1.21915 WP_001278605.1.21948 WP_001278605.1.21962 WP_001278605.1.2198 WP_001278605.1.21986 WP_001278605.1.21992 WP_001278605.1.22021 WP_001278605.1.22042 WP_001278605.1.22060 WP_001278605.1.22088 WP_001278605.1.22113 WP_001278605.1.22138 WP_001278605.1.22161 WP_001278605.1.2218 WP_001278605.1.22182 WP_001278605.1.22189 WP_001278605.1.22195 WP_001278605.1.22203 WP_001278605.1.22204 WP_001278605.1.22251 WP_001278605.1.22268 WP_001278605.1.22269 WP_001278605.1.22272 WP_001278605.1.22280 WP_001278605.1.22291 WP_001278605.1.22293 WP_001278605.1.22295 WP_001278605.1.22304 WP_001278605.1.22314 WP_001278605.1.2232 WP_001278605.1.22325 WP_001278605.1.22328 WP_001278605.1.22350 WP_001278605.1.22359 WP_001278605.1.22363 WP_001278605.1.22381 WP_001278605.1.22409 WP_001278605.1.2242 WP_001278605.1.22431 WP_001278605.1.2245 WP_001278605.1.22450 WP_001278605.1.22464 WP_001278605.1.22470 WP_001278605.1.22494 WP_001278605.1.22501 WP_001278605.1.22508 WP_001278605.1.22522 WP_001278605.1.22543 WP_001278605.1.22544 WP_001278605.1.22549 WP_001278605.1.22571 WP_001278605.1.22572 WP_001278605.1.22574 WP_001278605.1.22576 WP_001278605.1.22579 WP_001278605.1.22594 WP_001278605.1.22599 WP_001278605.1.22602 WP_001278605.1.22631 WP_001278605.1.22632 WP_001278605.1.22641 WP_001278605.1.22649 WP_001278605.1.22667 WP_001278605.1.22669 WP_001278605.1.22685 WP_001278605.1.22690 WP_001278605.1.22691 WP_001278605.1.22743 WP_001278605.1.22756 WP_001278605.1.22757 WP_001278605.1.22759 WP_001278605.1.22765 WP_001278605.1.22771 WP_001278605.1.22777 WP_001278605.1.22783 WP_001278605.1.22809 WP_001278605.1.22814 WP_001278605.1.22824 WP_001278605.1.22827 WP_001278605.1.22830 WP_001278605.1.22846 WP_001278605.1.22868 WP_001278605.1.22875 WP_001278605.1.22878 WP_001278605.1.22885 WP_001278605.1.22896 WP_001278605.1.22908 WP_001278605.1.22917 WP_001278605.1.22925 WP_001278605.1.22939 WP_001278605.1.22961 WP_001278605.1.22988 WP_001278605.1.22990 WP_001278605.1.22993 WP_001278605.1.2300 WP_001278605.1.23005 WP_001278605.1.23021 WP_001278605.1.23026 WP_001278605.1.23035 WP_001278605.1.23042 WP_001278605.1.23044 WP_001278605.1.23045 WP_001278605.1.23057 WP_001278605.1.23062 WP_001278605.1.23073 WP_001278605.1.23078 WP_001278605.1.23081 WP_001278605.1.23090 WP_001278605.1.23092 WP_001278605.1.23105 WP_001278605.1.23109 WP_001278605.1.23115 WP_001278605.1.23120 WP_001278605.1.23135 WP_001278605.1.2322 WP_001278605.1.23230 WP_001278605.1.23241 WP_001278605.1.2325 WP_001278605.1.23257 WP_001278605.1.23270 WP_001278605.1.23282 WP_001278605.1.23285 WP_001278605.1.23290 WP_001278605.1.23293 WP_001278605.1.23299 WP_001278605.1.23323 WP_001278605.1.23330 WP_001278605.1.23351 WP_001278605.1.23352 WP_001278605.1.23355 WP_001278605.1.23376 WP_001278605.1.23378 WP_001278605.1.23383 WP_001278605.1.23386 WP_001278605.1.23388 WP_001278605.1.23393 WP_001278605.1.23435 WP_001278605.1.23443 WP_001278605.1.23456 WP_001278605.1.23463 WP_001278605.1.23467 WP_001278605.1.23486 WP_001278605.1.23487 WP_001278605.1.23511 WP_001278605.1.23520 WP_001278605.1.23522 WP_001278605.1.23527 WP_001278605.1.2353 WP_001278605.1.23549 WP_001278605.1.23554 WP_001278605.1.23561 WP_001278605.1.23563 WP_001278605.1.23575 WP_001278605.1.23584 WP_001278605.1.23593 WP_001278605.1.2362 WP_001278605.1.23622 WP_001278605.1.23625 WP_001278605.1.23640 WP_001278605.1.23660 WP_001278605.1.23676 WP_001278605.1.23686 WP_001278605.1.23693 WP_001278605.1.23700 WP_001278605.1.23711 WP_001278605.1.23724 WP_001278605.1.23729 WP_001278605.1.23741 WP_001278605.1.23752 WP_001278605.1.23754 WP_001278605.1.23765 WP_001278605.1.23790 WP_001278605.1.23795 WP_001278605.1.23804 WP_001278605.1.23806 WP_001278605.1.23812 WP_001278605.1.23838 WP_001278605.1.23840 WP_001278605.1.23855 WP_001278605.1.23869 WP_001278605.1.2388 WP_001278605.1.23881 WP_001278605.1.23886 WP_001278605.1.23890 WP_001278605.1.23895 WP_001278605.1.23898 WP_001278605.1.23899 WP_001278605.1.23914 WP_001278605.1.23915 WP_001278605.1.23931 WP_001278605.1.23945 WP_001278605.1.2395 WP_001278605.1.23950 WP_001278605.1.23960 WP_001278605.1.23962 WP_001278605.1.23971 WP_001278605.1.23973 WP_001278605.1.23984 WP_001278605.1.23985 WP_001278605.1.24 WP_001278605.1.24004 WP_001278605.1.24024 WP_001278605.1.24038 WP_001278605.1.24045 WP_001278605.1.24051 WP_001278605.1.24058 WP_001278605.1.24068 WP_001278605.1.24070 WP_001278605.1.24088 WP_001278605.1.24089 WP_001278605.1.24120 WP_001278605.1.24124 WP_001278605.1.24127 WP_001278605.1.2413 WP_001278605.1.24136 WP_001278605.1.24169 WP_001278605.1.24170 WP_001278605.1.24177 WP_001278605.1.2418 WP_001278605.1.24194 WP_001278605.1.24278 WP_001278605.1.2428 WP_001278605.1.24283 WP_001278605.1.24290 WP_001278605.1.24304 WP_001278605.1.24316 WP_001278605.1.2433 WP_001278605.1.24341 WP_001278605.1.24362 WP_001278605.1.2437 WP_001278605.1.24374 WP_001278605.1.24381 WP_001278605.1.24383 WP_001278605.1.24458 WP_001278605.1.24460 WP_001278605.1.24473 WP_001278605.1.24483 WP_001278605.1.24485 WP_001278605.1.2449 WP_001278605.1.24499 WP_001278605.1.24523 WP_001278605.1.24524 WP_001278605.1.24533 WP_001278605.1.24536 WP_001278605.1.24547 WP_001278605.1.2456 WP_001278605.1.24560 WP_001278605.1.24570 WP_001278605.1.24575 WP_001278605.1.24577 WP_001278605.1.24583 WP_001278605.1.24592 WP_001278605.1.24616 WP_001278605.1.24634 WP_001278605.1.24641 WP_001278605.1.24642 WP_001278605.1.24646 WP_001278605.1.24650 WP_001278605.1.2469 WP_001278605.1.24693 WP_001278605.1.24695 WP_001278605.1.24703 WP_001278605.1.24752 WP_001278605.1.24753 WP_001278605.1.24758 WP_001278605.1.24763 WP_001278605.1.24773 WP_001278605.1.24783 WP_001278605.1.2479 WP_001278605.1.24791 WP_001278605.1.24797 WP_001278605.1.24799 WP_001278605.1.24808 WP_001278605.1.24849 WP_001278605.1.24854 WP_001278605.1.24870 WP_001278605.1.24876 WP_001278605.1.24899 WP_001278605.1.24906 WP_001278605.1.24909 WP_001278605.1.24926 WP_001278605.1.24929 WP_001278605.1.24939 WP_001278605.1.24946 WP_001278605.1.24960 WP_001278605.1.24968 WP_001278605.1.24979 WP_001278605.1.24981 WP_001278605.1.24982 WP_001278605.1.24984 WP_001278605.1.25019 WP_001278605.1.2502 WP_001278605.1.25021 WP_001278605.1.25038 WP_001278605.1.25039 WP_001278605.1.2504 WP_001278605.1.25042 WP_001278605.1.25050 WP_001278605.1.25060 WP_001278605.1.25076 WP_001278605.1.25079 WP_001278605.1.25082 WP_001278605.1.25085 WP_001278605.1.25086 WP_001278605.1.25087 WP_001278605.1.25088 WP_001278605.1.2512 WP_001278605.1.25126 WP_001278605.1.25141 WP_001278605.1.25174 WP_001278605.1.25183 WP_001278605.1.25193 WP_001278605.1.25201 WP_001278605.1.25203 WP_001278605.1.25204 WP_001278605.1.25248 WP_001278605.1.25270 WP_001278605.1.25272 WP_001278605.1.25289 WP_001278605.1.25305 WP_001278605.1.2531 WP_001278605.1.25312 WP_001278605.1.25324 WP_001278605.1.25346 WP_001278605.1.2537 WP_001278605.1.25378 WP_001278605.1.25380 WP_001278605.1.254 WP_001278605.1.2540 WP_001278605.1.25403 WP_001278605.1.25414 WP_001278605.1.25420 WP_001278605.1.2543 WP_001278605.1.25446 WP_001278605.1.25480 WP_001278605.1.255 WP_001278605.1.25525 WP_001278605.1.25526 WP_001278605.1.25548 WP_001278605.1.25577 WP_001278605.1.2558 WP_001278605.1.25592 WP_001278605.1.25598 WP_001278605.1.25602 WP_001278605.1.25612 WP_001278605.1.25613 WP_001278605.1.25631 WP_001278605.1.25643 WP_001278605.1.25652 WP_001278605.1.2567 WP_001278605.1.25680 WP_001278605.1.25681 WP_001278605.1.25701 WP_001278605.1.25712 WP_001278605.1.25713 WP_001278605.1.25717 WP_001278605.1.25718 WP_001278605.1.25724 WP_001278605.1.25726 WP_001278605.1.25750 WP_001278605.1.25753 WP_001278605.1.25755 WP_001278605.1.25794 WP_001278605.1.25799 WP_001278605.1.25819 WP_001278605.1.25831 WP_001278605.1.25832 WP_001278605.1.25843 WP_001278605.1.25855 WP_001278605.1.25869 WP_001278605.1.25873 WP_001278605.1.2588 WP_001278605.1.25886 WP_001278605.1.2589 WP_001278605.1.25890 WP_001278605.1.25895 WP_001278605.1.25915 WP_001278605.1.2597 WP_001278605.1.25996 WP_001278605.1.26005 WP_001278605.1.26040 WP_001278605.1.26048 WP_001278605.1.26055 WP_001278605.1.2606 WP_001278605.1.26061 WP_001278605.1.26066 WP_001278605.1.26076 WP_001278605.1.26092 WP_001278605.1.26100 WP_001278605.1.26105 WP_001278605.1.2612 WP_001278605.1.26121 WP_001278605.1.26125 WP_001278605.1.26130 WP_001278605.1.26131 WP_001278605.1.26134 WP_001278605.1.26135 WP_001278605.1.26150 WP_001278605.1.26161 WP_001278605.1.26175 WP_001278605.1.26186 WP_001278605.1.26189 WP_001278605.1.26191 WP_001278605.1.26196 WP_001278605.1.26246 WP_001278605.1.26259 WP_001278605.1.26262 WP_001278605.1.26264 WP_001278605.1.26270 WP_001278605.1.26284 WP_001278605.1.26304 WP_001278605.1.26325 WP_001278605.1.26331 WP_001278605.1.2637 WP_001278605.1.26379 WP_001278605.1.26391 WP_001278605.1.26398 WP_001278605.1.26401 WP_001278605.1.26403 WP_001278605.1.26419 WP_001278605.1.2642 WP_001278605.1.26438 WP_001278605.1.26467 WP_001278605.1.26474 WP_001278605.1.26479 WP_001278605.1.26480 WP_001278605.1.26517 WP_001278605.1.26525 WP_001278605.1.26569 WP_001278605.1.26570 WP_001278605.1.26574 WP_001278605.1.26575 WP_001278605.1.26579 WP_001278605.1.26588 WP_001278605.1.26590 WP_001278605.1.26598 WP_001278605.1.26609 WP_001278605.1.26613 WP_001278605.1.26627 WP_001278605.1.26644 WP_001278605.1.2665 WP_001278605.1.26658 WP_001278605.1.26659 WP_001278605.1.26660 WP_001278605.1.26683 WP_001278605.1.26688 WP_001278605.1.26716 WP_001278605.1.26720 WP_001278605.1.26761 WP_001278605.1.26766 WP_001278605.1.26782 WP_001278605.1.26837 WP_001278605.1.26839 WP_001278605.1.26861 WP_001278605.1.26878 WP_001278605.1.2688 WP_001278605.1.26912 WP_001278605.1.26932 WP_001278605.1.26941 WP_001278605.1.2695 WP_001278605.1.26950 WP_001278605.1.26975 WP_001278605.1.26987 WP_001278605.1.26995 WP_001278605.1.26998 WP_001278605.1.2700 WP_001278605.1.27019 WP_001278605.1.27043 WP_001278605.1.27057 WP_001278605.1.27060 WP_001278605.1.27091 WP_001278605.1.27098 WP_001278605.1.27101 WP_001278605.1.27105 WP_001278605.1.2712 WP_001278605.1.27134 WP_001278605.1.27141 WP_001278605.1.27148 WP_001278605.1.27175 WP_001278605.1.27188 WP_001278605.1.27214 WP_001278605.1.27234 WP_001278605.1.27260 WP_001278605.1.27280 WP_001278605.1.27283 WP_001278605.1.27287 WP_001278605.1.27292 WP_001278605.1.2731 WP_001278605.1.27310 WP_001278605.1.27313 WP_001278605.1.27330 WP_001278605.1.27338 WP_001278605.1.27367 WP_001278605.1.27373 WP_001278605.1.27396 WP_001278605.1.27401 WP_001278605.1.27424 WP_001278605.1.27426 WP_001278605.1.27445 WP_001278605.1.2745 WP_001278605.1.27451 WP_001278605.1.27472 WP_001278605.1.27504 WP_001278605.1.27518 WP_001278605.1.27520 WP_001278605.1.27524 WP_001278605.1.2755 WP_001278605.1.27560 WP_001278605.1.27580 WP_001278605.1.27585 WP_001278605.1.27611 WP_001278605.1.27618 WP_001278605.1.27683 WP_001278605.1.27693 WP_001278605.1.27698 WP_001278605.1.27723 WP_001278605.1.27741 WP_001278605.1.27742 WP_001278605.1.27749 WP_001278605.1.27758 WP_001278605.1.27774 WP_001278605.1.27786 WP_001278605.1.2779 WP_001278605.1.27797 WP_001278605.1.2782 WP_001278605.1.27846 WP_001278605.1.27856 WP_001278605.1.27861 WP_001278605.1.27871 WP_001278605.1.27879 WP_001278605.1.27897 WP_001278605.1.27913 WP_001278605.1.27923 WP_001278605.1.27932 WP_001278605.1.2794 WP_001278605.1.27957 WP_001278605.1.27971 WP_001278605.1.27998 WP_001278605.1.28008 WP_001278605.1.28026 WP_001278605.1.28027 WP_001278605.1.28046 WP_001278605.1.28051 WP_001278605.1.28102 WP_001278605.1.28109 WP_001278605.1.28110 WP_001278605.1.28128 WP_001278605.1.28143 WP_001278605.1.28145 WP_001278605.1.28156 WP_001278605.1.28167 WP_001278605.1.28168 WP_001278605.1.28184 WP_001278605.1.28199 WP_001278605.1.28250 WP_001278605.1.2826 WP_001278605.1.28268 WP_001278605.1.28271 WP_001278605.1.28305 WP_001278605.1.28314 WP_001278605.1.28318 WP_001278605.1.28322 WP_001278605.1.28345 WP_001278605.1.28349 WP_001278605.1.28371 WP_001278605.1.2838 WP_001278605.1.28401 WP_001278605.1.28414 WP_001278605.1.28433 WP_001278605.1.28440 WP_001278605.1.28461 WP_001278605.1.28476 WP_001278605.1.28480 WP_001278605.1.28491 WP_001278605.1.28496 WP_001278605.1.285 WP_001278605.1.28500 WP_001278605.1.28509 WP_001278605.1.28523 WP_001278605.1.28536 WP_001278605.1.28540 WP_001278605.1.28544 WP_001278605.1.28551 WP_001278605.1.28554 WP_001278605.1.28568 WP_001278605.1.28639 WP_001278605.1.2866 WP_001278605.1.28662 WP_001278605.1.28683 WP_001278605.1.28697 WP_001278605.1.28711 WP_001278605.1.28723 WP_001278605.1.28732 WP_001278605.1.28734 WP_001278605.1.28736 WP_001278605.1.28742 WP_001278605.1.28760 WP_001278605.1.28762 WP_001278605.1.28769 WP_001278605.1.28791 WP_001278605.1.28809 WP_001278605.1.2881 WP_001278605.1.28829 WP_001278605.1.28835 WP_001278605.1.28842 WP_001278605.1.28863 WP_001278605.1.28879 WP_001278605.1.28919 WP_001278605.1.28924 WP_001278605.1.28950 WP_001278605.1.28953 WP_001278605.1.28982 WP_001278605.1.28994 WP_001278605.1.290 WP_001278605.1.29001 WP_001278605.1.29013 WP_001278605.1.29016 WP_001278605.1.29026 WP_001278605.1.29049 WP_001278605.1.29055 WP_001278605.1.29061 WP_001278605.1.29079 WP_001278605.1.29082 WP_001278605.1.291 WP_001278605.1.29100 WP_001278605.1.29118 WP_001278605.1.29125 WP_001278605.1.29126 WP_001278605.1.29128 WP_001278605.1.29146 WP_001278605.1.29150 WP_001278605.1.29164 WP_001278605.1.29176 WP_001278605.1.29194 WP_001278605.1.29197 WP_001278605.1.29202 WP_001278605.1.29206 WP_001278605.1.29230 WP_001278605.1.29239 WP_001278605.1.29252 WP_001278605.1.29258 WP_001278605.1.2926 WP_001278605.1.2931 WP_001278605.1.29341 WP_001278605.1.29377 WP_001278605.1.29394 WP_001278605.1.29404 WP_001278605.1.2942 WP_001278605.1.29429 WP_001278605.1.29443 WP_001278605.1.2945 WP_001278605.1.29486 WP_001278605.1.29495 WP_001278605.1.29497 WP_001278605.1.29503 WP_001278605.1.29504 WP_001278605.1.29513 WP_001278605.1.2952 WP_001278605.1.29523 WP_001278605.1.2954 WP_001278605.1.29556 WP_001278605.1.29564 WP_001278605.1.29590 WP_001278605.1.29597 WP_001278605.1.29603 WP_001278605.1.29618 WP_001278605.1.2963 WP_001278605.1.29643 WP_001278605.1.29647 WP_001278605.1.29662 WP_001278605.1.29669 WP_001278605.1.29683 WP_001278605.1.29689 WP_001278605.1.29699 WP_001278605.1.29715 WP_001278605.1.29724 WP_001278605.1.29740 WP_001278605.1.29746 WP_001278605.1.29752 WP_001278605.1.2978 WP_001278605.1.29798 WP_001278605.1.29812 WP_001278605.1.29815 WP_001278605.1.29818 WP_001278605.1.29819 WP_001278605.1.29820 WP_001278605.1.29821 WP_001278605.1.29840 WP_001278605.1.29855 WP_001278605.1.2986 WP_001278605.1.29874 WP_001278605.1.29876 WP_001278605.1.29884 WP_001278605.1.29933 WP_001278605.1.2995 WP_001278605.1.29967 WP_001278605.1.29976 WP_001278605.1.29979 WP_001278605.1.29988 WP_001278605.1.29992 WP_001278605.1.30 WP_001278605.1.30004 WP_001278605.1.30016 WP_001278605.1.30019 WP_001278605.1.30035 WP_001278605.1.30052 WP_001278605.1.30063 WP_001278605.1.30064 WP_001278605.1.30098 WP_001278605.1.30105 WP_001278605.1.30123 WP_001278605.1.30141 WP_001278605.1.30164 WP_001278605.1.3018 WP_001278605.1.30221 WP_001278605.1.30231 WP_001278605.1.30232 WP_001278605.1.30239 WP_001278605.1.30247 WP_001278605.1.30253 WP_001278605.1.30269 WP_001278605.1.30298 WP_001278605.1.30347 WP_001278605.1.30391 WP_001278605.1.30397 WP_001278605.1.30399 WP_001278605.1.30400 WP_001278605.1.30401 WP_001278605.1.30428 WP_001278605.1.30447 WP_001278605.1.3045 WP_001278605.1.30452 WP_001278605.1.30472 WP_001278605.1.30476 WP_001278605.1.30479 WP_001278605.1.30497 WP_001278605.1.30524 WP_001278605.1.30536 WP_001278605.1.30546 WP_001278605.1.3055 WP_001278605.1.30550 WP_001278605.1.30554 WP_001278605.1.30570 WP_001278605.1.30580 WP_001278605.1.306 WP_001278605.1.3063 WP_001278605.1.30630 WP_001278605.1.30637 WP_001278605.1.30639 WP_001278605.1.30640 WP_001278605.1.30658 WP_001278605.1.30665 WP_001278605.1.30691 WP_001278605.1.30700 WP_001278605.1.30733 WP_001278605.1.30742 WP_001278605.1.30749 WP_001278605.1.30762 WP_001278605.1.30783 WP_001278605.1.30808 WP_001278605.1.3083 WP_001278605.1.30843 WP_001278605.1.30853 WP_001278605.1.30866 WP_001278605.1.30867 WP_001278605.1.30879 WP_001278605.1.30887 WP_001278605.1.30896 WP_001278605.1.309 WP_001278605.1.30905 WP_001278605.1.30906 WP_001278605.1.30918 WP_001278605.1.30960 WP_001278605.1.30987 WP_001278605.1.30993 WP_001278605.1.30999 WP_001278605.1.31000 WP_001278605.1.31009 WP_001278605.1.31017 WP_001278605.1.31026 WP_001278605.1.31029 WP_001278605.1.31055 WP_001278605.1.31083 WP_001278605.1.31089 WP_001278605.1.31119 WP_001278605.1.31129 WP_001278605.1.31142 WP_001278605.1.31149 WP_001278605.1.31154 WP_001278605.1.31188 WP_001278605.1.312 WP_001278605.1.31211 WP_001278605.1.31252 WP_001278605.1.31295 WP_001278605.1.31340 WP_001278605.1.31347 WP_001278605.1.31353 WP_001278605.1.31357 WP_001278605.1.31379 WP_001278605.1.3140 WP_001278605.1.31401 WP_001278605.1.31407 WP_001278605.1.31419 WP_001278605.1.31421 WP_001278605.1.31422 WP_001278605.1.31429 WP_001278605.1.31431 WP_001278605.1.31433 WP_001278605.1.31434 WP_001278605.1.3147 WP_001278605.1.31482 WP_001278605.1.31506 WP_001278605.1.31509 WP_001278605.1.31511 WP_001278605.1.31518 WP_001278605.1.31521 WP_001278605.1.31527 WP_001278605.1.31542 WP_001278605.1.31557 WP_001278605.1.31559 WP_001278605.1.31575 WP_001278605.1.31596 WP_001278605.1.31614 WP_001278605.1.31625 WP_001278605.1.31639 WP_001278605.1.31657 WP_001278605.1.31675 WP_001278605.1.31679 WP_001278605.1.31681 WP_001278605.1.3169 WP_001278605.1.31696 WP_001278605.1.31709 WP_001278605.1.31715 WP_001278605.1.31736 WP_001278605.1.31740 WP_001278605.1.3176 WP_001278605.1.31801 WP_001278605.1.31803 WP_001278605.1.31809 WP_001278605.1.3181 WP_001278605.1.31823 WP_001278605.1.31825 WP_001278605.1.31833 WP_001278605.1.31835 WP_001278605.1.31839 WP_001278605.1.31860 WP_001278605.1.31863 WP_001278605.1.31866 WP_001278605.1.31898 WP_001278605.1.31899 WP_001278605.1.31903 WP_001278605.1.31924 WP_001278605.1.31928 WP_001278605.1.3193 WP_001278605.1.31937 WP_001278605.1.31956 WP_001278605.1.31978 WP_001278605.1.3201 WP_001278605.1.32020 WP_001278605.1.32021 WP_001278605.1.32024 WP_001278605.1.3203 WP_001278605.1.32030 WP_001278605.1.32037 WP_001278605.1.32049 WP_001278605.1.32063 WP_001278605.1.32078 WP_001278605.1.32089 WP_001278605.1.32091 WP_001278605.1.32093 WP_001278605.1.32094 WP_001278605.1.3212 WP_001278605.1.32121 WP_001278605.1.32127 WP_001278605.1.32138 WP_001278605.1.32142 WP_001278605.1.32143 WP_001278605.1.3215 WP_001278605.1.32173 WP_001278605.1.32184 WP_001278605.1.322 WP_001278605.1.32225 WP_001278605.1.32232 WP_001278605.1.32234 WP_001278605.1.32236 WP_001278605.1.32242 WP_001278605.1.32243 WP_001278605.1.32279 WP_001278605.1.32287 WP_001278605.1.3233 WP_001278605.1.32333 WP_001278605.1.32394 WP_001278605.1.32406 WP_001278605.1.32432 WP_001278605.1.32435 WP_001278605.1.32443 WP_001278605.1.32448 WP_001278605.1.3247 WP_001278605.1.32475 WP_001278605.1.32478 WP_001278605.1.32479 WP_001278605.1.3248 WP_001278605.1.32480 WP_001278605.1.32494 WP_001278605.1.32509 WP_001278605.1.32518 WP_001278605.1.32536 WP_001278605.1.32558 WP_001278605.1.32561 WP_001278605.1.32574 WP_001278605.1.32580 WP_001278605.1.32587 WP_001278605.1.3259 WP_001278605.1.32590 WP_001278605.1.32591 WP_001278605.1.32601 WP_001278605.1.32635 WP_001278605.1.32650 WP_001278605.1.32655 WP_001278605.1.32661 WP_001278605.1.32676 WP_001278605.1.32680 WP_001278605.1.3269 WP_001278605.1.327 WP_001278605.1.32709 WP_001278605.1.32715 WP_001278605.1.32718 WP_001278605.1.32720 WP_001278605.1.32722 WP_001278605.1.32724 WP_001278605.1.32741 WP_001278605.1.32748 WP_001278605.1.32772 WP_001278605.1.32811 WP_001278605.1.32815 WP_001278605.1.32831 WP_001278605.1.32835 WP_001278605.1.32875 WP_001278605.1.32888 WP_001278605.1.32903 WP_001278605.1.32910 WP_001278605.1.32931 WP_001278605.1.32938 WP_001278605.1.32946 WP_001278605.1.3295 WP_001278605.1.32959 WP_001278605.1.32972 WP_001278605.1.32984 WP_001278605.1.32992 WP_001278605.1.32995 WP_001278605.1.33004 WP_001278605.1.33014 WP_001278605.1.33018 WP_001278605.1.33022 WP_001278605.1.33026 WP_001278605.1.33046 WP_001278605.1.33049 WP_001278605.1.33053 WP_001278605.1.33055 WP_001278605.1.33094 WP_001278605.1.33101 WP_001278605.1.33119 WP_001278605.1.33125 WP_001278605.1.33146 WP_001278605.1.33167 WP_001278605.1.33171 WP_001278605.1.33178 WP_001278605.1.33179 WP_001278605.1.33190 WP_001278605.1.33217 WP_001278605.1.33222 WP_001278605.1.3323 WP_001278605.1.33237 WP_001278605.1.33238 WP_001278605.1.33244 WP_001278605.1.33268 WP_001278605.1.33303 WP_001278605.1.33325 WP_001278605.1.33341 WP_001278605.1.33352 WP_001278605.1.33362 WP_001278605.1.33369 WP_001278605.1.33385 WP_001278605.1.334 WP_001278605.1.33408 WP_001278605.1.33410 WP_001278605.1.33413 WP_001278605.1.33422 WP_001278605.1.33424 WP_001278605.1.33428 WP_001278605.1.3344 WP_001278605.1.33475 WP_001278605.1.33476 WP_001278605.1.33502 WP_001278605.1.33525 WP_001278605.1.33526 WP_001278605.1.3354 WP_001278605.1.33545 WP_001278605.1.33561 WP_001278605.1.33563 WP_001278605.1.33565 WP_001278605.1.33584 WP_001278605.1.33595 WP_001278605.1.33631 WP_001278605.1.33638 WP_001278605.1.33648 WP_001278605.1.33667 WP_001278605.1.33680 WP_001278605.1.33729 WP_001278605.1.33736 WP_001278605.1.33745 WP_001278605.1.33746 WP_001278605.1.33751 WP_001278605.1.33780 WP_001278605.1.33799 WP_001278605.1.33823 WP_001278605.1.33853 WP_001278605.1.33854 WP_001278605.1.33879 WP_001278605.1.33888 WP_001278605.1.33896 WP_001278605.1.33905 WP_001278605.1.33914 WP_001278605.1.33948 WP_001278605.1.33952 WP_001278605.1.33973 WP_001278605.1.33974 WP_001278605.1.33979 WP_001278605.1.3398 WP_001278605.1.33981 WP_001278605.1.34003 WP_001278605.1.3401 WP_001278605.1.34032 WP_001278605.1.34094 WP_001278605.1.3411 WP_001278605.1.34117 WP_001278605.1.34121 WP_001278605.1.34122 WP_001278605.1.34124 WP_001278605.1.34130 WP_001278605.1.34144 WP_001278605.1.3415 WP_001278605.1.342 WP_001278605.1.34204 WP_001278605.1.34206 WP_001278605.1.34208 WP_001278605.1.34224 WP_001278605.1.34269 WP_001278605.1.34270 WP_001278605.1.34273 WP_001278605.1.34277 WP_001278605.1.34294 WP_001278605.1.34303 WP_001278605.1.3432 WP_001278605.1.34332 WP_001278605.1.34341 WP_001278605.1.34348 WP_001278605.1.34362 WP_001278605.1.34363 WP_001278605.1.34380 WP_001278605.1.34383 WP_001278605.1.3439 WP_001278605.1.34397 WP_001278605.1.34422 WP_001278605.1.3444 WP_001278605.1.34440 WP_001278605.1.34441 WP_001278605.1.34444 WP_001278605.1.34456 WP_001278605.1.34464 WP_001278605.1.34470 WP_001278605.1.34500 WP_001278605.1.34525 WP_001278605.1.34528 WP_001278605.1.34538 WP_001278605.1.34541 WP_001278605.1.34557 WP_001278605.1.34558 WP_001278605.1.3460 WP_001278605.1.34605 WP_001278605.1.34617 WP_001278605.1.34655 WP_001278605.1.34668 WP_001278605.1.34675 WP_001278605.1.34680 WP_001278605.1.34682 WP_001278605.1.34683 WP_001278605.1.34686 WP_001278605.1.3469 WP_001278605.1.347 WP_001278605.1.3472 WP_001278605.1.34727 WP_001278605.1.34763 WP_001278605.1.34781 WP_001278605.1.34782 WP_001278605.1.34794 WP_001278605.1.34827 WP_001278605.1.34835 WP_001278605.1.34838 WP_001278605.1.34855 WP_001278605.1.34875 WP_001278605.1.34887 WP_001278605.1.34913 WP_001278605.1.34931 WP_001278605.1.34948 WP_001278605.1.34966 WP_001278605.1.34982 WP_001278605.1.34983 WP_001278605.1.34990 WP_001278605.1.34993 WP_001278605.1.35003 WP_001278605.1.35006 WP_001278605.1.35007 WP_001278605.1.35012 WP_001278605.1.35039 WP_001278605.1.35107 WP_001278605.1.35114 WP_001278605.1.35127 WP_001278605.1.35132 WP_001278605.1.3515 WP_001278605.1.35168 WP_001278605.1.35180 WP_001278605.1.35186 WP_001278605.1.35195 WP_001278605.1.35198 WP_001278605.1.35202 WP_001278605.1.35204 WP_001278605.1.35208 WP_001278605.1.3521 WP_001278605.1.35211 WP_001278605.1.35220 WP_001278605.1.35253 WP_001278605.1.35258 WP_001278605.1.35316 WP_001278605.1.35328 WP_001278605.1.35349 WP_001278605.1.35360 WP_001278605.1.35365 WP_001278605.1.35368 WP_001278605.1.35376 WP_001278605.1.3539 WP_001278605.1.35393 WP_001278605.1.35394 WP_001278605.1.35398 WP_001278605.1.35448 WP_001278605.1.35464 WP_001278605.1.35465 WP_001278605.1.35466 WP_001278605.1.35468 WP_001278605.1.35483 WP_001278605.1.3550 WP_001278605.1.35552 WP_001278605.1.35578 WP_001278605.1.35581 WP_001278605.1.3560 WP_001278605.1.35604 WP_001278605.1.35627 WP_001278605.1.35632 WP_001278605.1.35649 WP_001278605.1.35651 WP_001278605.1.35653 WP_001278605.1.35654 WP_001278605.1.35698 WP_001278605.1.35704 WP_001278605.1.35724 WP_001278605.1.35740 WP_001278605.1.35741 WP_001278605.1.35744 WP_001278605.1.35789 WP_001278605.1.35889 WP_001278605.1.35904 WP_001278605.1.35922 WP_001278605.1.35927 WP_001278605.1.35934 WP_001278605.1.35942 WP_001278605.1.35959 WP_001278605.1.35963 WP_001278605.1.3598 WP_001278605.1.35983 WP_001278605.1.35985 WP_001278605.1.35987 WP_001278605.1.35990 WP_001278605.1.3600 WP_001278605.1.36010 WP_001278605.1.36040 WP_001278605.1.36042 WP_001278605.1.36070 WP_001278605.1.36071 WP_001278605.1.36085 WP_001278605.1.36094 WP_001278605.1.36105 WP_001278605.1.36129 WP_001278605.1.36132 WP_001278605.1.36158 WP_001278605.1.36159 WP_001278605.1.36166 WP_001278605.1.36177 WP_001278605.1.36182 WP_001278605.1.3620 WP_001278605.1.36207 WP_001278605.1.36212 WP_001278605.1.3624 WP_001278605.1.36281 WP_001278605.1.36299 WP_001278605.1.36332 WP_001278605.1.36334 WP_001278605.1.36352 WP_001278605.1.36386 WP_001278605.1.36393 WP_001278605.1.36405 WP_001278605.1.36412 WP_001278605.1.36414 WP_001278605.1.36426 WP_001278605.1.3643 WP_001278605.1.36453 WP_001278605.1.36459 WP_001278605.1.36496 WP_001278605.1.365 WP_001278605.1.36500 WP_001278605.1.36507 WP_001278605.1.36523 WP_001278605.1.36531 WP_001278605.1.36537 WP_001278605.1.36545 WP_001278605.1.36610 WP_001278605.1.36626 WP_001278605.1.36627 WP_001278605.1.36628 WP_001278605.1.36667 WP_001278605.1.3668 WP_001278605.1.36699 WP_001278605.1.36707 WP_001278605.1.3671 WP_001278605.1.36724 WP_001278605.1.36739 WP_001278605.1.36746 WP_001278605.1.36747 WP_001278605.1.36761 WP_001278605.1.36767 WP_001278605.1.36786 WP_001278605.1.36799 WP_001278605.1.36806 WP_001278605.1.36812 WP_001278605.1.36817 WP_001278605.1.36826 WP_001278605.1.36833 WP_001278605.1.36856 WP_001278605.1.36886 WP_001278605.1.36904 WP_001278605.1.36925 WP_001278605.1.3697 WP_001278605.1.36971 WP_001278605.1.36975 WP_001278605.1.37006 WP_001278605.1.37020 WP_001278605.1.37032 WP_001278605.1.37046 WP_001278605.1.37049 WP_001278605.1.37057 WP_001278605.1.37076 WP_001278605.1.37099 WP_001278605.1.37101 WP_001278605.1.37102 WP_001278605.1.37103 WP_001278605.1.37122 WP_001278605.1.37146 WP_001278605.1.37153 WP_001278605.1.37155 WP_001278605.1.37206 WP_001278605.1.37226 WP_001278605.1.3723 WP_001278605.1.37252 WP_001278605.1.37261 WP_001278605.1.37266 WP_001278605.1.37290 WP_001278605.1.3730 WP_001278605.1.37306 WP_001278605.1.37312 WP_001278605.1.37313 WP_001278605.1.37329 WP_001278605.1.37334 WP_001278605.1.37337 WP_001278605.1.37342 WP_001278605.1.37352 WP_001278605.1.37360 WP_001278605.1.37371 WP_001278605.1.37372 WP_001278605.1.37388 WP_001278605.1.37419 WP_001278605.1.37423 WP_001278605.1.37445 WP_001278605.1.37472 WP_001278605.1.37476 WP_001278605.1.37477 WP_001278605.1.37485 WP_001278605.1.3749 WP_001278605.1.37510 WP_001278605.1.37516 WP_001278605.1.37538 WP_001278605.1.37543 WP_001278605.1.37544 WP_001278605.1.37548 WP_001278605.1.37549 WP_001278605.1.37550 WP_001278605.1.37554 WP_001278605.1.37576 WP_001278605.1.37588 WP_001278605.1.37592 WP_001278605.1.37608 WP_001278605.1.3762 WP_001278605.1.37634 WP_001278605.1.37637 WP_001278605.1.37664 WP_001278605.1.377 WP_001278605.1.3772 WP_001278605.1.37730 WP_001278605.1.37731 WP_001278605.1.37736 WP_001278605.1.37745 WP_001278605.1.37750 WP_001278605.1.37758 WP_001278605.1.37762 WP_001278605.1.37766 WP_001278605.1.37769 WP_001278605.1.37773 WP_001278605.1.37817 WP_001278605.1.37847 WP_001278605.1.37852 WP_001278605.1.37853 WP_001278605.1.3788 WP_001278605.1.37880 WP_001278605.1.37887 WP_001278605.1.37897 WP_001278605.1.37917 WP_001278605.1.37923 WP_001278605.1.37926 WP_001278605.1.37940 WP_001278605.1.3795 WP_001278605.1.3796 WP_001278605.1.37962 WP_001278605.1.37964 WP_001278605.1.37967 WP_001278605.1.37984 WP_001278605.1.37995 WP_001278605.1.37998 WP_001278605.1.38000 WP_001278605.1.38033 WP_001278605.1.38043 WP_001278605.1.38050 WP_001278605.1.38063 WP_001278605.1.38080 WP_001278605.1.38081 WP_001278605.1.38085 WP_001278605.1.38103 WP_001278605.1.38105 WP_001278605.1.38107 WP_001278605.1.3811 WP_001278605.1.38119 WP_001278605.1.38120 WP_001278605.1.3815 WP_001278605.1.38155 WP_001278605.1.38162 WP_001278605.1.38182 WP_001278605.1.38185 WP_001278605.1.38194 WP_001278605.1.38202 WP_001278605.1.38211 WP_001278605.1.3822 WP_001278605.1.38234 WP_001278605.1.38257 WP_001278605.1.38264 WP_001278605.1.38293 WP_001278605.1.38300 WP_001278605.1.38306 WP_001278605.1.38314 WP_001278605.1.38323 WP_001278605.1.38357 WP_001278605.1.38363 WP_001278605.1.38369 WP_001278605.1.38371 WP_001278605.1.38392 WP_001278605.1.38412 WP_001278605.1.38419 WP_001278605.1.38485 WP_001278605.1.38533 WP_001278605.1.38544 WP_001278605.1.38561 WP_001278605.1.38567 WP_001278605.1.38584 WP_001278605.1.38610 WP_001278605.1.38626 WP_001278605.1.38629 WP_001278605.1.38636 WP_001278605.1.38694 WP_001278605.1.38722 WP_001278605.1.3873 WP_001278605.1.38751 WP_001278605.1.38777 WP_001278605.1.38782 WP_001278605.1.38811 WP_001278605.1.38827 WP_001278605.1.38835 WP_001278605.1.38843 WP_001278605.1.38896 WP_001278605.1.389 WP_001278605.1.38911 WP_001278605.1.38920 WP_001278605.1.38935 WP_001278605.1.38937 WP_001278605.1.38950 WP_001278605.1.38956 WP_001278605.1.38958 WP_001278605.1.39005 WP_001278605.1.39015 WP_001278605.1.3903 WP_001278605.1.39037 WP_001278605.1.3904 WP_001278605.1.39042 WP_001278605.1.39063 WP_001278605.1.39103 WP_001278605.1.39111 WP_001278605.1.3912 WP_001278605.1.39123 WP_001278605.1.39148 WP_001278605.1.39150 WP_001278605.1.39155 WP_001278605.1.39157 WP_001278605.1.39164 WP_001278605.1.39167 WP_001278605.1.39171 WP_001278605.1.39180 WP_001278605.1.39184 WP_001278605.1.39196 WP_001278605.1.39209 WP_001278605.1.3921 WP_001278605.1.3922 WP_001278605.1.39232 WP_001278605.1.39249 WP_001278605.1.39254 WP_001278605.1.39268 WP_001278605.1.39289 WP_001278605.1.39302 WP_001278605.1.39305 WP_001278605.1.39310 WP_001278605.1.39313 WP_001278605.1.39325 WP_001278605.1.39327 WP_001278605.1.39335 WP_001278605.1.39342 WP_001278605.1.39356 WP_001278605.1.39358 WP_001278605.1.39365 WP_001278605.1.39367 WP_001278605.1.39373 WP_001278605.1.39377 WP_001278605.1.39401 WP_001278605.1.39402 WP_001278605.1.39415 WP_001278605.1.39423 WP_001278605.1.39430 WP_001278605.1.39468 WP_001278605.1.39481 WP_001278605.1.39492 WP_001278605.1.39509 WP_001278605.1.39531 WP_001278605.1.3954 WP_001278605.1.39541 WP_001278605.1.39564 WP_001278605.1.39575 WP_001278605.1.39580 WP_001278605.1.39594 WP_001278605.1.39601 WP_001278605.1.39606 WP_001278605.1.39607 WP_001278605.1.39610 WP_001278605.1.39626 WP_001278605.1.39646 WP_001278605.1.39651 WP_001278605.1.39690 WP_001278605.1.3970 WP_001278605.1.39708 WP_001278605.1.39709 WP_001278605.1.39713 WP_001278605.1.39715 WP_001278605.1.39717 WP_001278605.1.39726 WP_001278605.1.39730 WP_001278605.1.39733 WP_001278605.1.39734 WP_001278605.1.39758 WP_001278605.1.39780 WP_001278605.1.39796 WP_001278605.1.3980 WP_001278605.1.39809 WP_001278605.1.39818 WP_001278605.1.39820 WP_001278605.1.39822 WP_001278605.1.39867 WP_001278605.1.39870 WP_001278605.1.39892 WP_001278605.1.39938 WP_001278605.1.39961 WP_001278605.1.39966 WP_001278605.1.39970 WP_001278605.1.39973 WP_001278605.1.39992 WP_001278605.1.39998 WP_001278605.1.40 WP_001278605.1.40013 WP_001278605.1.40016 WP_001278605.1.40019 WP_001278605.1.4005 WP_001278605.1.40083 WP_001278605.1.40088 WP_001278605.1.40107 WP_001278605.1.40113 WP_001278605.1.40121 WP_001278605.1.40140 WP_001278605.1.40147 WP_001278605.1.40153 WP_001278605.1.40159 WP_001278605.1.40183 WP_001278605.1.40190 WP_001278605.1.40192 WP_001278605.1.4020 WP_001278605.1.40206 WP_001278605.1.40211 WP_001278605.1.40212 WP_001278605.1.40218 WP_001278605.1.40234 WP_001278605.1.40238 WP_001278605.1.40249 WP_001278605.1.40298 WP_001278605.1.4030 WP_001278605.1.40300 WP_001278605.1.40315 WP_001278605.1.40317 WP_001278605.1.40319 WP_001278605.1.40335 WP_001278605.1.40345 WP_001278605.1.40349 WP_001278605.1.40360 WP_001278605.1.40382 WP_001278605.1.40389 WP_001278605.1.40391 WP_001278605.1.40403 WP_001278605.1.40445 WP_001278605.1.40486 WP_001278605.1.40499 WP_001278605.1.40502 WP_001278605.1.40509 WP_001278605.1.40524 WP_001278605.1.40539 WP_001278605.1.40548 WP_001278605.1.40549 WP_001278605.1.40560 WP_001278605.1.40563 WP_001278605.1.40596 WP_001278605.1.40599 WP_001278605.1.406 WP_001278605.1.40607 WP_001278605.1.40617 WP_001278605.1.40623 WP_001278605.1.40629 WP_001278605.1.40636 WP_001278605.1.40657 WP_001278605.1.40660 WP_001278605.1.40666 WP_001278605.1.40668 WP_001278605.1.40686 WP_001278605.1.40712 WP_001278605.1.40715 WP_001278605.1.40742 WP_001278605.1.40758 WP_001278605.1.40781 WP_001278605.1.40793 WP_001278605.1.4081 WP_001278605.1.40813 WP_001278605.1.40815 WP_001278605.1.4082 WP_001278605.1.40833 WP_001278605.1.40842 WP_001278605.1.40843 WP_001278605.1.40865 WP_001278605.1.40882 WP_001278605.1.40893 WP_001278605.1.40898 WP_001278605.1.40900 WP_001278605.1.40912 WP_001278605.1.40937 WP_001278605.1.40952 WP_001278605.1.40965 WP_001278605.1.4103 WP_001278605.1.41037 WP_001278605.1.41041 WP_001278605.1.41045 WP_001278605.1.41060 WP_001278605.1.41063 WP_001278605.1.41078 WP_001278605.1.41113 WP_001278605.1.41125 WP_001278605.1.41147 WP_001278605.1.41206 WP_001278605.1.4122 WP_001278605.1.41230 WP_001278605.1.41239 WP_001278605.1.41244 WP_001278605.1.41259 WP_001278605.1.4126 WP_001278605.1.41263 WP_001278605.1.41271 WP_001278605.1.41287 WP_001278605.1.41294 WP_001278605.1.41315 WP_001278605.1.41330 WP_001278605.1.41332 WP_001278605.1.41339 WP_001278605.1.41346 WP_001278605.1.41363 WP_001278605.1.41368 WP_001278605.1.41371 WP_001278605.1.41372 WP_001278605.1.41391 WP_001278605.1.41392 WP_001278605.1.41394 WP_001278605.1.41401 WP_001278605.1.41402 WP_001278605.1.41407 WP_001278605.1.41417 WP_001278605.1.4142 WP_001278605.1.41436 WP_001278605.1.41449 WP_001278605.1.41453 WP_001278605.1.41455 WP_001278605.1.41457 WP_001278605.1.41466 WP_001278605.1.41478 WP_001278605.1.41479 WP_001278605.1.41481 WP_001278605.1.41482 WP_001278605.1.41483 WP_001278605.1.41484 WP_001278605.1.41488 WP_001278605.1.41513 WP_001278605.1.41530 WP_001278605.1.41536 WP_001278605.1.41545 WP_001278605.1.41556 WP_001278605.1.41566 WP_001278605.1.4158 WP_001278605.1.41606 WP_001278605.1.41613 WP_001278605.1.41621 WP_001278605.1.41651 WP_001278605.1.41654 WP_001278605.1.41712 WP_001278605.1.41718 WP_001278605.1.4172 WP_001278605.1.41734 WP_001278605.1.41740 WP_001278605.1.41741 WP_001278605.1.41752 WP_001278605.1.41778 WP_001278605.1.41780 WP_001278605.1.41782 WP_001278605.1.41783 WP_001278605.1.41809 WP_001278605.1.41812 WP_001278605.1.41813 WP_001278605.1.41822 WP_001278605.1.41826 WP_001278605.1.41837 WP_001278605.1.41849 WP_001278605.1.41884 WP_001278605.1.41885 WP_001278605.1.4189 WP_001278605.1.41900 WP_001278605.1.41923 WP_001278605.1.4193 WP_001278605.1.41956 WP_001278605.1.41960 WP_001278605.1.41964 WP_001278605.1.41988 WP_001278605.1.41990 WP_001278605.1.41991 WP_001278605.1.42022 WP_001278605.1.42027 WP_001278605.1.42033 WP_001278605.1.42036 WP_001278605.1.42038 WP_001278605.1.42044 WP_001278605.1.42060 WP_001278605.1.42073 WP_001278605.1.42095 WP_001278605.1.42096 WP_001278605.1.42113 WP_001278605.1.4213 WP_001278605.1.42138 WP_001278605.1.4214 WP_001278605.1.42151 WP_001278605.1.42159 WP_001278605.1.42179 WP_001278605.1.42191 WP_001278605.1.42203 WP_001278605.1.42209 WP_001278605.1.42214 WP_001278605.1.42221 WP_001278605.1.42226 WP_001278605.1.42228 WP_001278605.1.4224 WP_001278605.1.42252 WP_001278605.1.42258 WP_001278605.1.42277 WP_001278605.1.42284 WP_001278605.1.42300 WP_001278605.1.42318 WP_001278605.1.42350 WP_001278605.1.42359 WP_001278605.1.42367 WP_001278605.1.42369 WP_001278605.1.42376 WP_001278605.1.42387 WP_001278605.1.42413 WP_001278605.1.42415 WP_001278605.1.4242 WP_001278605.1.42432 WP_001278605.1.42442 WP_001278605.1.42443 WP_001278605.1.42447 WP_001278605.1.42448 WP_001278605.1.42456 WP_001278605.1.42480 WP_001278605.1.4250 WP_001278605.1.42513 WP_001278605.1.42516 WP_001278605.1.42522 WP_001278605.1.42547 WP_001278605.1.42586 WP_001278605.1.42594 WP_001278605.1.42597 WP_001278605.1.42600 WP_001278605.1.42601 WP_001278605.1.4261 WP_001278605.1.42632 WP_001278605.1.42638 WP_001278605.1.42661 WP_001278605.1.42669 WP_001278605.1.42670 WP_001278605.1.42677 WP_001278605.1.42709 WP_001278605.1.42728 WP_001278605.1.42748 WP_001278605.1.42749 WP_001278605.1.42750 WP_001278605.1.42756 WP_001278605.1.42761 WP_001278605.1.42770 WP_001278605.1.42771 WP_001278605.1.42791 WP_001278605.1.42804 WP_001278605.1.42808 WP_001278605.1.42813 WP_001278605.1.4282 WP_001278605.1.42828 WP_001278605.1.42830 WP_001278605.1.42832 WP_001278605.1.42863 WP_001278605.1.42879 WP_001278605.1.42880 WP_001278605.1.42891 WP_001278605.1.4290 WP_001278605.1.42918 WP_001278605.1.42936 WP_001278605.1.42937 WP_001278605.1.42950 WP_001278605.1.42962 WP_001278605.1.42966 WP_001278605.1.42970 WP_001278605.1.42975 WP_001278605.1.42987 WP_001278605.1.42989 WP_001278605.1.42991 WP_001278605.1.43013 WP_001278605.1.43027 WP_001278605.1.43035 WP_001278605.1.4306 WP_001278605.1.43079 WP_001278605.1.43121 WP_001278605.1.43123 WP_001278605.1.4313 WP_001278605.1.43132 WP_001278605.1.43137 WP_001278605.1.43140 WP_001278605.1.43166 WP_001278605.1.43170 WP_001278605.1.43174 WP_001278605.1.43177 WP_001278605.1.43196 WP_001278605.1.43213 WP_001278605.1.43216 WP_001278605.1.43239 WP_001278605.1.43270 WP_001278605.1.43278 WP_001278605.1.43316 WP_001278605.1.43324 WP_001278605.1.4334 WP_001278605.1.43363 WP_001278605.1.43374 WP_001278605.1.43384 WP_001278605.1.4342 WP_001278605.1.43422 WP_001278605.1.43427 WP_001278605.1.4343 WP_001278605.1.43444 WP_001278605.1.43448 WP_001278605.1.43455 WP_001278605.1.43469 WP_001278605.1.43473 WP_001278605.1.43474 WP_001278605.1.43489 WP_001278605.1.43501 WP_001278605.1.43536 WP_001278605.1.4356 WP_001278605.1.43561 WP_001278605.1.43566 WP_001278605.1.43598 WP_001278605.1.436 WP_001278605.1.43604 WP_001278605.1.43622 WP_001278605.1.43642 WP_001278605.1.43720 WP_001278605.1.43733 WP_001278605.1.43738 WP_001278605.1.43750 WP_001278605.1.43754 WP_001278605.1.43769 WP_001278605.1.43798 WP_001278605.1.43803 WP_001278605.1.43804 WP_001278605.1.43816 WP_001278605.1.43837 WP_001278605.1.43858 WP_001278605.1.43868 WP_001278605.1.43898 WP_001278605.1.43911 WP_001278605.1.43918 WP_001278605.1.43925 WP_001278605.1.43939 WP_001278605.1.43942 WP_001278605.1.43953 WP_001278605.1.43966 WP_001278605.1.43989 WP_001278605.1.440 WP_001278605.1.4400 WP_001278605.1.44018 WP_001278605.1.44020 WP_001278605.1.44029 WP_001278605.1.44040 WP_001278605.1.44051 WP_001278605.1.44075 WP_001278605.1.44077 WP_001278605.1.44088 WP_001278605.1.44096 WP_001278605.1.44100 WP_001278605.1.4411 WP_001278605.1.44115 WP_001278605.1.44125 WP_001278605.1.44130 WP_001278605.1.4415 WP_001278605.1.44162 WP_001278605.1.44165 WP_001278605.1.44166 WP_001278605.1.44201 WP_001278605.1.44203 WP_001278605.1.44211 WP_001278605.1.44222 WP_001278605.1.44238 WP_001278605.1.44263 WP_001278605.1.44264 WP_001278605.1.44273 WP_001278605.1.44285 WP_001278605.1.44287 WP_001278605.1.44292 WP_001278605.1.44314 WP_001278605.1.44324 WP_001278605.1.44327 WP_001278605.1.44354 WP_001278605.1.44365 WP_001278605.1.44389 WP_001278605.1.44394 WP_001278605.1.44422 WP_001278605.1.44424 WP_001278605.1.44426 WP_001278605.1.44445 WP_001278605.1.44447 WP_001278605.1.4445 WP_001278605.1.44452 WP_001278605.1.44458 WP_001278605.1.44460 WP_001278605.1.44461 WP_001278605.1.44488 WP_001278605.1.4449 WP_001278605.1.44524 WP_001278605.1.44539 WP_001278605.1.4454 WP_001278605.1.44558 WP_001278605.1.44561 WP_001278605.1.44587 WP_001278605.1.4459 WP_001278605.1.44608 WP_001278605.1.44610 WP_001278605.1.44622 WP_001278605.1.44627 WP_001278605.1.4463 WP_001278605.1.44642 WP_001278605.1.44649 WP_001278605.1.44661 WP_001278605.1.44668 WP_001278605.1.44671 WP_001278605.1.44686 WP_001278605.1.4471 WP_001278605.1.44717 WP_001278605.1.44724 WP_001278605.1.4473 WP_001278605.1.44733 WP_001278605.1.44756 WP_001278605.1.44759 WP_001278605.1.44784 WP_001278605.1.448 WP_001278605.1.44800 WP_001278605.1.44814 WP_001278605.1.44818 WP_001278605.1.44821 WP_001278605.1.44836 WP_001278605.1.44840 WP_001278605.1.44841 WP_001278605.1.44848 WP_001278605.1.44849 WP_001278605.1.44854 WP_001278605.1.44855 WP_001278605.1.44857 WP_001278605.1.44906 WP_001278605.1.44923 WP_001278605.1.44954 WP_001278605.1.44960 WP_001278605.1.44961 WP_001278605.1.44970 WP_001278605.1.44975 WP_001278605.1.44977 WP_001278605.1.44980 WP_001278605.1.45000 WP_001278605.1.45020 WP_001278605.1.45025 WP_001278605.1.45028 WP_001278605.1.45043 WP_001278605.1.45053 WP_001278605.1.45068 WP_001278605.1.45076 WP_001278605.1.45104 WP_001278605.1.45116 WP_001278605.1.45153 WP_001278605.1.45156 WP_001278605.1.4516 WP_001278605.1.45190 WP_001278605.1.45195 WP_001278605.1.45208 WP_001278605.1.4524 WP_001278605.1.45246 WP_001278605.1.45293 WP_001278605.1.4530 WP_001278605.1.45301 WP_001278605.1.45313 WP_001278605.1.45329 WP_001278605.1.4535 WP_001278605.1.45359 WP_001278605.1.4538 WP_001278605.1.45392 WP_001278605.1.45404 WP_001278605.1.45405 WP_001278605.1.4541 WP_001278605.1.45444 WP_001278605.1.45486 WP_001278605.1.4549 WP_001278605.1.45494 WP_001278605.1.45500 WP_001278605.1.45525 WP_001278605.1.45536 WP_001278605.1.45538 WP_001278605.1.45565 WP_001278605.1.45575 WP_001278605.1.45581 WP_001278605.1.45600 WP_001278605.1.45627 WP_001278605.1.4563 WP_001278605.1.45664 WP_001278605.1.45674 WP_001278605.1.45676 WP_001278605.1.4570 WP_001278605.1.45707 WP_001278605.1.45718 WP_001278605.1.4574 WP_001278605.1.45740 WP_001278605.1.45741 WP_001278605.1.45752 WP_001278605.1.4576 WP_001278605.1.45789 WP_001278605.1.45793 WP_001278605.1.45799 WP_001278605.1.45801 WP_001278605.1.45806 WP_001278605.1.4583 WP_001278605.1.45840 WP_001278605.1.45841 WP_001278605.1.45846 WP_001278605.1.45865 WP_001278605.1.45868 WP_001278605.1.45891 WP_001278605.1.45901 WP_001278605.1.45921 WP_001278605.1.4593 WP_001278605.1.45930 WP_001278605.1.45931 WP_001278605.1.45933 WP_001278605.1.45941 WP_001278605.1.45949 WP_001278605.1.45960 WP_001278605.1.45962 WP_001278605.1.45968 WP_001278605.1.45990 WP_001278605.1.45991 WP_001278605.1.4600 WP_001278605.1.46016 WP_001278605.1.46026 WP_001278605.1.46027 WP_001278605.1.46039 WP_001278605.1.46048 WP_001278605.1.46049 WP_001278605.1.46070 WP_001278605.1.46081 WP_001278605.1.46097 WP_001278605.1.4610 WP_001278605.1.46105 WP_001278605.1.46115 WP_001278605.1.46122 WP_001278605.1.4613 WP_001278605.1.46164 WP_001278605.1.4617 WP_001278605.1.46186 WP_001278605.1.4619 WP_001278605.1.46213 WP_001278605.1.46217 WP_001278605.1.46239 WP_001278605.1.46245 WP_001278605.1.46257 WP_001278605.1.46263 WP_001278605.1.46282 WP_001278605.1.46283 WP_001278605.1.46291 WP_001278605.1.46301 WP_001278605.1.46329 WP_001278605.1.46369 WP_001278605.1.46378 WP_001278605.1.46379 WP_001278605.1.46414 WP_001278605.1.46429 WP_001278605.1.4643 WP_001278605.1.46433 WP_001278605.1.46438 WP_001278605.1.46441 WP_001278605.1.46451 WP_001278605.1.4646 WP_001278605.1.46468 WP_001278605.1.4647 WP_001278605.1.46477 WP_001278605.1.46487 WP_001278605.1.46503 WP_001278605.1.46526 WP_001278605.1.46531 WP_001278605.1.46541 WP_001278605.1.46552 WP_001278605.1.46555 WP_001278605.1.4657 WP_001278605.1.46573 WP_001278605.1.46582 WP_001278605.1.46589 WP_001278605.1.46594 WP_001278605.1.46597 WP_001278605.1.46602 WP_001278605.1.46611 WP_001278605.1.46614 WP_001278605.1.46616 WP_001278605.1.46626 WP_001278605.1.46643 WP_001278605.1.46655 WP_001278605.1.46668 WP_001278605.1.4670 WP_001278605.1.46734 WP_001278605.1.46743 WP_001278605.1.46795 WP_001278605.1.46798 WP_001278605.1.46802 WP_001278605.1.46806 WP_001278605.1.46810 WP_001278605.1.46821 WP_001278605.1.46832 WP_001278605.1.46833 WP_001278605.1.46841 WP_001278605.1.46857 WP_001278605.1.46860 WP_001278605.1.46876 WP_001278605.1.46882 WP_001278605.1.46898 WP_001278605.1.46909 WP_001278605.1.4691 WP_001278605.1.46912 WP_001278605.1.46913 WP_001278605.1.46932 WP_001278605.1.4695 WP_001278605.1.46990 WP_001278605.1.46991 WP_001278605.1.46994 WP_001278605.1.46999 WP_001278605.1.47024 WP_001278605.1.47028 WP_001278605.1.47029 WP_001278605.1.47030 WP_001278605.1.47034 WP_001278605.1.47038 WP_001278605.1.47039 WP_001278605.1.47047 WP_001278605.1.47048 WP_001278605.1.47050 WP_001278605.1.47054 WP_001278605.1.47063 WP_001278605.1.47069 WP_001278605.1.47073 WP_001278605.1.4708 WP_001278605.1.47124 WP_001278605.1.47135 WP_001278605.1.47140 WP_001278605.1.47156 WP_001278605.1.47167 WP_001278605.1.47186 WP_001278605.1.47189 WP_001278605.1.47197 WP_001278605.1.47198 WP_001278605.1.4722 WP_001278605.1.47224 WP_001278605.1.4723 WP_001278605.1.47235 WP_001278605.1.47246 WP_001278605.1.47247 WP_001278605.1.4725 WP_001278605.1.47280 WP_001278605.1.47307 WP_001278605.1.47316 WP_001278605.1.47319 WP_001278605.1.47332 WP_001278605.1.47344 WP_001278605.1.47349 WP_001278605.1.47350 WP_001278605.1.47356 WP_001278605.1.47363 WP_001278605.1.47366 WP_001278605.1.47370 WP_001278605.1.47386 WP_001278605.1.47398 WP_001278605.1.4740 WP_001278605.1.47401 WP_001278605.1.47411 WP_001278605.1.47414 WP_001278605.1.47416 WP_001278605.1.47425 WP_001278605.1.4743 WP_001278605.1.47451 WP_001278605.1.47454 WP_001278605.1.47464 WP_001278605.1.47473 WP_001278605.1.47477 WP_001278605.1.47488 WP_001278605.1.47496 WP_001278605.1.47498 WP_001278605.1.47500 WP_001278605.1.47529 WP_001278605.1.47533 WP_001278605.1.47546 WP_001278605.1.47555 WP_001278605.1.47582 WP_001278605.1.47599 WP_001278605.1.47634 WP_001278605.1.47646 WP_001278605.1.47654 WP_001278605.1.47662 WP_001278605.1.47709 WP_001278605.1.4772 WP_001278605.1.47722 WP_001278605.1.4773 WP_001278605.1.47734 WP_001278605.1.47740 WP_001278605.1.47744 WP_001278605.1.47761 WP_001278605.1.47764 WP_001278605.1.47765 WP_001278605.1.47770 WP_001278605.1.47775 WP_001278605.1.47784 WP_001278605.1.47790 WP_001278605.1.47791 WP_001278605.1.47820 WP_001278605.1.47827 WP_001278605.1.4783 WP_001278605.1.47848 WP_001278605.1.4785 WP_001278605.1.47884 WP_001278605.1.47914 WP_001278605.1.47935 WP_001278605.1.47954 WP_001278605.1.4796 WP_001278605.1.47962 WP_001278605.1.47976 WP_001278605.1.47981 WP_001278605.1.47983 WP_001278605.1.47994 WP_001278605.1.48000 WP_001278605.1.48018 WP_001278605.1.48029 WP_001278605.1.48040 WP_001278605.1.48048 WP_001278605.1.48051 WP_001278605.1.48065 WP_001278605.1.48073 WP_001278605.1.48077 WP_001278605.1.48080 WP_001278605.1.48087 WP_001278605.1.48090 WP_001278605.1.4811 WP_001278605.1.48111 WP_001278605.1.4812 WP_001278605.1.48121 WP_001278605.1.48144 WP_001278605.1.48168 WP_001278605.1.48176 WP_001278605.1.48188 WP_001278605.1.48194 WP_001278605.1.48203 WP_001278605.1.48216 WP_001278605.1.48222 WP_001278605.1.48226 WP_001278605.1.48229 WP_001278605.1.48258 WP_001278605.1.4826 WP_001278605.1.48265 WP_001278605.1.48285 WP_001278605.1.48290 WP_001278605.1.48291 WP_001278605.1.48317 WP_001278605.1.48353 WP_001278605.1.48355 WP_001278605.1.48371 WP_001278605.1.48385 WP_001278605.1.48404 WP_001278605.1.48417 WP_001278605.1.48421 WP_001278605.1.48431 WP_001278605.1.48433 WP_001278605.1.48469 WP_001278605.1.48477 WP_001278605.1.48483 WP_001278605.1.48505 WP_001278605.1.48522 WP_001278605.1.4857 WP_001278605.1.48571 WP_001278605.1.48590 WP_001278605.1.486 WP_001278605.1.48602 WP_001278605.1.48615 WP_001278605.1.48620 WP_001278605.1.48626 WP_001278605.1.48629 WP_001278605.1.48678 WP_001278605.1.48689 WP_001278605.1.48697 WP_001278605.1.4871 WP_001278605.1.48712 WP_001278605.1.4876 WP_001278605.1.48771 WP_001278605.1.48792 WP_001278605.1.48801 WP_001278605.1.48806 WP_001278605.1.48808 WP_001278605.1.48825 WP_001278605.1.48827 WP_001278605.1.48847 WP_001278605.1.48860 WP_001278605.1.48901 WP_001278605.1.48902 WP_001278605.1.48907 WP_001278605.1.48910 WP_001278605.1.4892 WP_001278605.1.48921 WP_001278605.1.48926 WP_001278605.1.48928 WP_001278605.1.48953 WP_001278605.1.48954 WP_001278605.1.48970 WP_001278605.1.48974 WP_001278605.1.49001 WP_001278605.1.49009 WP_001278605.1.49061 WP_001278605.1.49076 WP_001278605.1.49104 WP_001278605.1.49107 WP_001278605.1.49124 WP_001278605.1.49136 WP_001278605.1.49147 WP_001278605.1.49170 WP_001278605.1.49179 WP_001278605.1.49229 WP_001278605.1.49236 WP_001278605.1.49243 WP_001278605.1.49258 WP_001278605.1.49259 WP_001278605.1.49275 WP_001278605.1.4931 WP_001278605.1.49312 WP_001278605.1.49321 WP_001278605.1.49332 WP_001278605.1.49336 WP_001278605.1.49338 WP_001278605.1.49342 WP_001278605.1.49347 WP_001278605.1.49363 WP_001278605.1.49376 WP_001278605.1.49401 WP_001278605.1.49412 WP_001278605.1.49431 WP_001278605.1.49446 WP_001278605.1.49459 WP_001278605.1.49464 WP_001278605.1.49481 WP_001278605.1.49482 WP_001278605.1.49483 WP_001278605.1.4949 WP_001278605.1.49496 WP_001278605.1.49521 WP_001278605.1.49522 WP_001278605.1.49528 WP_001278605.1.4953 WP_001278605.1.49531 WP_001278605.1.49537 WP_001278605.1.49546 WP_001278605.1.49558 WP_001278605.1.49567 WP_001278605.1.49594 WP_001278605.1.49599 WP_001278605.1.49615 WP_001278605.1.49621 WP_001278605.1.49625 WP_001278605.1.49645 WP_001278605.1.49655 WP_001278605.1.49661 WP_001278605.1.49662 WP_001278605.1.49675 WP_001278605.1.49684 WP_001278605.1.497 WP_001278605.1.49712 WP_001278605.1.49722 WP_001278605.1.49733 WP_001278605.1.49740 WP_001278605.1.49747 WP_001278605.1.49768 WP_001278605.1.49771 WP_001278605.1.49774 WP_001278605.1.49777 WP_001278605.1.49783 WP_001278605.1.49788 WP_001278605.1.49794 WP_001278605.1.49820 WP_001278605.1.49823 WP_001278605.1.4985 WP_001278605.1.49856 WP_001278605.1.49861 WP_001278605.1.49879 WP_001278605.1.49883 WP_001278605.1.49884 WP_001278605.1.49900 WP_001278605.1.49902 WP_001278605.1.49941 WP_001278605.1.49950 WP_001278605.1.49954 WP_001278605.1.49972 WP_001278605.1.49987 WP_001278605.1.50006 WP_001278605.1.50008 WP_001278605.1.5003 WP_001278605.1.50036 WP_001278605.1.50056 WP_001278605.1.50058 WP_001278605.1.50078 WP_001278605.1.50098 WP_001278605.1.50110 WP_001278605.1.50113 WP_001278605.1.50119 WP_001278605.1.50136 WP_001278605.1.50146 WP_001278605.1.5017 WP_001278605.1.50179 WP_001278605.1.50182 WP_001278605.1.50187 WP_001278605.1.50191 WP_001278605.1.50196 WP_001278605.1.50207 WP_001278605.1.50214 WP_001278605.1.50228 WP_001278605.1.50230 WP_001278605.1.50258 WP_001278605.1.50262 WP_001278605.1.50266 WP_001278605.1.50269 WP_001278605.1.50270 WP_001278605.1.50273 WP_001278605.1.50278 WP_001278605.1.50304 WP_001278605.1.50329 WP_001278605.1.50345 WP_001278605.1.50353 WP_001278605.1.50361 WP_001278605.1.50366 WP_001278605.1.5037 WP_001278605.1.50380 WP_001278605.1.50381 WP_001278605.1.5040 WP_001278605.1.5041 WP_001278605.1.50412 WP_001278605.1.50418 WP_001278605.1.50427 WP_001278605.1.50446 WP_001278605.1.50452 WP_001278605.1.5046 WP_001278605.1.50539 WP_001278605.1.50548 WP_001278605.1.50549 WP_001278605.1.5056 WP_001278605.1.50564 WP_001278605.1.50579 WP_001278605.1.50585 WP_001278605.1.50586 WP_001278605.1.506 WP_001278605.1.50608 WP_001278605.1.5061 WP_001278605.1.50616 WP_001278605.1.50627 WP_001278605.1.5064 WP_001278605.1.5067 WP_001278605.1.50690 WP_001278605.1.50700 WP_001278605.1.50715 WP_001278605.1.50717 WP_001278605.1.50725 WP_001278605.1.50728 WP_001278605.1.50762 WP_001278605.1.50887 WP_001278605.1.50936 WP_001278605.1.50939 WP_001278605.1.50947 WP_001278605.1.5095 WP_001278605.1.50969 WP_001278605.1.50986 WP_001278605.1.50988 WP_001278605.1.50990 WP_001278605.1.50993 WP_001278605.1.50996 WP_001278605.1.51013 WP_001278605.1.51027 WP_001278605.1.51042 WP_001278605.1.51058 WP_001278605.1.5106 WP_001278605.1.511 WP_001278605.1.51109 WP_001278605.1.51127 WP_001278605.1.51154 WP_001278605.1.51170 WP_001278605.1.51171 WP_001278605.1.51172 WP_001278605.1.51175 WP_001278605.1.51180 WP_001278605.1.51190 WP_001278605.1.51201 WP_001278605.1.51203 WP_001278605.1.51206 WP_001278605.1.51211 WP_001278605.1.5124 WP_001278605.1.51248 WP_001278605.1.51253 WP_001278605.1.51255 WP_001278605.1.51260 WP_001278605.1.51278 WP_001278605.1.5128 WP_001278605.1.51283 WP_001278605.1.51299 WP_001278605.1.51300 WP_001278605.1.51307 WP_001278605.1.51320 WP_001278605.1.51323 WP_001278605.1.51325 WP_001278605.1.51330 WP_001278605.1.51336 WP_001278605.1.51354 WP_001278605.1.51360 WP_001278605.1.51364 WP_001278605.1.51380 WP_001278605.1.51392 WP_001278605.1.51405 WP_001278605.1.51425 WP_001278605.1.51426 WP_001278605.1.51427 WP_001278605.1.51430 WP_001278605.1.51441 WP_001278605.1.5146 WP_001278605.1.51462 WP_001278605.1.51482 WP_001278605.1.51490 WP_001278605.1.51495 WP_001278605.1.51503 WP_001278605.1.51505 WP_001278605.1.51513 WP_001278605.1.51525 WP_001278605.1.5153 WP_001278605.1.51537 WP_001278605.1.51539 WP_001278605.1.51542 WP_001278605.1.51548 WP_001278605.1.51552 WP_001278605.1.5157 WP_001278605.1.5158 WP_001278605.1.51580 WP_001278605.1.51587 WP_001278605.1.51596 WP_001278605.1.51600 WP_001278605.1.51607 WP_001278605.1.51624 WP_001278605.1.51629 WP_001278605.1.51643 WP_001278605.1.51662 WP_001278605.1.51690 WP_001278605.1.51693 WP_001278605.1.51707 WP_001278605.1.51718 WP_001278605.1.5172 WP_001278605.1.51736 WP_001278605.1.51757 WP_001278605.1.51760 WP_001278605.1.51784 WP_001278605.1.518 WP_001278605.1.51804 WP_001278605.1.51834 WP_001278605.1.51837 WP_001278605.1.51839 WP_001278605.1.51869 WP_001278605.1.51881 WP_001278605.1.51896 WP_001278605.1.51899 WP_001278605.1.51906 WP_001278605.1.51944 WP_001278605.1.51968 WP_001278605.1.51979 WP_001278605.1.51985 WP_001278605.1.51988 WP_001278605.1.5199 WP_001278605.1.51999 WP_001278605.1.52002 WP_001278605.1.52011 WP_001278605.1.52020 WP_001278605.1.52039 WP_001278605.1.52044 WP_001278605.1.52048 WP_001278605.1.52062 WP_001278605.1.52076 WP_001278605.1.52085 WP_001278605.1.52098 WP_001278605.1.52111 WP_001278605.1.52126 WP_001278605.1.52127 WP_001278605.1.52135 WP_001278605.1.52137 WP_001278605.1.5217 WP_001278605.1.52171 WP_001278605.1.52186 WP_001278605.1.52200 WP_001278605.1.52211 WP_001278605.1.52213 WP_001278605.1.52214 WP_001278605.1.52225 WP_001278605.1.52230 WP_001278605.1.52236 WP_001278605.1.52240 WP_001278605.1.52243 WP_001278605.1.52249 WP_001278605.1.52257 WP_001278605.1.52258 WP_001278605.1.5227 WP_001278605.1.52270 WP_001278605.1.52271 WP_001278605.1.52272 WP_001278605.1.52299 WP_001278605.1.52304 WP_001278605.1.52305 WP_001278605.1.52313 WP_001278605.1.52324 WP_001278605.1.52328 WP_001278605.1.52333 WP_001278605.1.52363 WP_001278605.1.52378 WP_001278605.1.5239 WP_001278605.1.52399 WP_001278605.1.52406 WP_001278605.1.52413 WP_001278605.1.52419 WP_001278605.1.52421 WP_001278605.1.52492 WP_001278605.1.52496 WP_001278605.1.52524 WP_001278605.1.52542 WP_001278605.1.52543 WP_001278605.1.52544 WP_001278605.1.52554 WP_001278605.1.52558 WP_001278605.1.52567 WP_001278605.1.52568 WP_001278605.1.52601 WP_001278605.1.52612 WP_001278605.1.52631 WP_001278605.1.52662 WP_001278605.1.52691 WP_001278605.1.52704 WP_001278605.1.52710 WP_001278605.1.5272 WP_001278605.1.52735 WP_001278605.1.52755 WP_001278605.1.52762 WP_001278605.1.52771 WP_001278605.1.52774 WP_001278605.1.52777 WP_001278605.1.52780 WP_001278605.1.52781 WP_001278605.1.52801 WP_001278605.1.52804 WP_001278605.1.52844 WP_001278605.1.52846 WP_001278605.1.5285 WP_001278605.1.52852 WP_001278605.1.52853 WP_001278605.1.52855 WP_001278605.1.52881 WP_001278605.1.52883 WP_001278605.1.52895 WP_001278605.1.52908 WP_001278605.1.5291 WP_001278605.1.52913 WP_001278605.1.52933 WP_001278605.1.52942 WP_001278605.1.52945 WP_001278605.1.52962 WP_001278605.1.52995 WP_001278605.1.52996 WP_001278605.1.53012 WP_001278605.1.53020 WP_001278605.1.53021 WP_001278605.1.53027 WP_001278605.1.53095 WP_001278605.1.53099 WP_001278605.1.5310 WP_001278605.1.53110 WP_001278605.1.53123 WP_001278605.1.53155 WP_001278605.1.53162 WP_001278605.1.53181 WP_001278605.1.53186 WP_001278605.1.532 WP_001278605.1.53211 WP_001278605.1.5322 WP_001278605.1.53223 WP_001278605.1.53228 WP_001278605.1.53238 WP_001278605.1.53242 WP_001278605.1.53244 WP_001278605.1.53251 WP_001278605.1.53252 WP_001278605.1.53262 WP_001278605.1.53270 WP_001278605.1.53277 WP_001278605.1.53308 WP_001278605.1.53327 WP_001278605.1.53356 WP_001278605.1.53360 WP_001278605.1.53364 WP_001278605.1.53377 WP_001278605.1.53401 WP_001278605.1.53410 WP_001278605.1.53415 WP_001278605.1.53419 WP_001278605.1.5342 WP_001278605.1.53428 WP_001278605.1.53431 WP_001278605.1.53482 WP_001278605.1.53505 WP_001278605.1.5351 WP_001278605.1.53535 WP_001278605.1.53537 WP_001278605.1.53545 WP_001278605.1.53556 WP_001278605.1.53557 WP_001278605.1.53574 WP_001278605.1.53582 WP_001278605.1.53587 WP_001278605.1.53589 WP_001278605.1.53590 WP_001278605.1.53592 WP_001278605.1.53594 WP_001278605.1.5362 WP_001278605.1.53642 WP_001278605.1.53645 WP_001278605.1.53649 WP_001278605.1.53687 WP_001278605.1.53690 WP_001278605.1.53693 WP_001278605.1.53706 WP_001278605.1.53769 WP_001278605.1.53809 WP_001278605.1.53810 WP_001278605.1.53811 WP_001278605.1.53841 WP_001278605.1.53863 WP_001278605.1.53866 WP_001278605.1.53878 WP_001278605.1.53884 WP_001278605.1.5391 WP_001278605.1.5393 WP_001278605.1.53931 WP_001278605.1.53940 WP_001278605.1.5395 WP_001278605.1.53966 WP_001278605.1.53968 WP_001278605.1.53972 WP_001278605.1.53978 WP_001278605.1.53991 WP_001278605.1.53994 WP_001278605.1.54002 WP_001278605.1.54013 WP_001278605.1.54023 WP_001278605.1.54024 WP_001278605.1.54028 WP_001278605.1.54032 WP_001278605.1.54051 WP_001278605.1.54072 WP_001278605.1.54091 WP_001278605.1.54095 WP_001278605.1.54102 WP_001278605.1.54104 WP_001278605.1.54144 WP_001278605.1.54169 WP_001278605.1.54185 WP_001278605.1.54188 WP_001278605.1.54202 WP_001278605.1.54208 WP_001278605.1.54213 WP_001278605.1.54263 WP_001278605.1.54307 WP_001278605.1.54313 WP_001278605.1.54317 WP_001278605.1.54328 WP_001278605.1.54329 WP_001278605.1.5433 WP_001278605.1.5434 WP_001278605.1.54344 WP_001278605.1.54359 WP_001278605.1.54388 WP_001278605.1.54394 WP_001278605.1.5440 WP_001278605.1.5441 WP_001278605.1.54411 WP_001278605.1.54417 WP_001278605.1.54418 WP_001278605.1.54429 WP_001278605.1.54439 WP_001278605.1.54454 WP_001278605.1.54463 WP_001278605.1.54476 WP_001278605.1.54507 WP_001278605.1.54524 WP_001278605.1.54534 WP_001278605.1.54546 WP_001278605.1.54585 WP_001278605.1.54590 WP_001278605.1.54591 WP_001278605.1.5460 WP_001278605.1.54601 WP_001278605.1.54602 WP_001278605.1.54605 WP_001278605.1.5461 WP_001278605.1.54614 WP_001278605.1.54617 WP_001278605.1.54620 WP_001278605.1.54638 WP_001278605.1.54641 WP_001278605.1.54643 WP_001278605.1.5467 WP_001278605.1.54688 WP_001278605.1.54695 WP_001278605.1.5470 WP_001278605.1.54708 WP_001278605.1.54725 WP_001278605.1.54729 WP_001278605.1.54754 WP_001278605.1.54755 WP_001278605.1.54760 WP_001278605.1.54769 WP_001278605.1.5478 WP_001278605.1.5479 WP_001278605.1.54798 WP_001278605.1.54817 WP_001278605.1.54829 WP_001278605.1.5486 WP_001278605.1.54875 WP_001278605.1.54883 WP_001278605.1.54918 WP_001278605.1.54921 WP_001278605.1.54927 WP_001278605.1.54940 WP_001278605.1.54941 WP_001278605.1.54946 WP_001278605.1.54972 WP_001278605.1.54981 WP_001278605.1.54989 WP_001278605.1.54991 WP_001278605.1.54993 WP_001278605.1.55003 WP_001278605.1.55005 WP_001278605.1.55009 WP_001278605.1.55041 WP_001278605.1.55070 WP_001278605.1.55112 WP_001278605.1.55115 WP_001278605.1.5512 WP_001278605.1.55134 WP_001278605.1.55144 WP_001278605.1.55149 WP_001278605.1.55151 WP_001278605.1.55177 WP_001278605.1.55179 WP_001278605.1.55185 WP_001278605.1.55197 WP_001278605.1.5520 WP_001278605.1.55203 WP_001278605.1.55218 WP_001278605.1.55222 WP_001278605.1.55226 WP_001278605.1.55273 WP_001278605.1.55275 WP_001278605.1.55286 WP_001278605.1.55291 WP_001278605.1.55338 WP_001278605.1.55342 WP_001278605.1.55357 WP_001278605.1.55359 WP_001278605.1.55374 WP_001278605.1.55381 WP_001278605.1.55417 WP_001278605.1.55420 WP_001278605.1.55424 WP_001278605.1.55425 WP_001278605.1.5546 WP_001278605.1.55466 WP_001278605.1.55472 WP_001278605.1.55482 WP_001278605.1.55483 WP_001278605.1.55489 WP_001278605.1.55492 WP_001278605.1.55529 WP_001278605.1.55550 WP_001278605.1.55551 WP_001278605.1.55552 WP_001278605.1.55556 WP_001278605.1.55560 WP_001278605.1.55563 WP_001278605.1.55571 WP_001278605.1.55574 WP_001278605.1.55581 WP_001278605.1.55597 WP_001278605.1.55608 WP_001278605.1.5561 WP_001278605.1.55629 WP_001278605.1.5566 WP_001278605.1.55676 WP_001278605.1.5570 WP_001278605.1.55709 WP_001278605.1.55720 WP_001278605.1.55727 WP_001278605.1.55730 WP_001278605.1.55731 WP_001278605.1.55744 WP_001278605.1.55787 WP_001278605.1.55790 WP_001278605.1.55791 WP_001278605.1.55808 WP_001278605.1.55820 WP_001278605.1.55825 WP_001278605.1.55838 WP_001278605.1.55844 WP_001278605.1.55868 WP_001278605.1.55870 WP_001278605.1.55888 WP_001278605.1.55892 WP_001278605.1.55896 WP_001278605.1.55897 WP_001278605.1.55936 WP_001278605.1.55979 WP_001278605.1.55981 WP_001278605.1.55988 WP_001278605.1.55990 WP_001278605.1.56033 WP_001278605.1.56040 WP_001278605.1.56047 WP_001278605.1.56072 WP_001278605.1.561 WP_001278605.1.56101 WP_001278605.1.56122 WP_001278605.1.56139 WP_001278605.1.5614 WP_001278605.1.56149 WP_001278605.1.56151 WP_001278605.1.5616 WP_001278605.1.56164 WP_001278605.1.56169 WP_001278605.1.56177 WP_001278605.1.56193 WP_001278605.1.56197 WP_001278605.1.562 WP_001278605.1.56216 WP_001278605.1.56231 WP_001278605.1.56278 WP_001278605.1.56285 WP_001278605.1.56293 WP_001278605.1.56302 WP_001278605.1.5632 WP_001278605.1.56338 WP_001278605.1.56345 WP_001278605.1.56358 WP_001278605.1.56371 WP_001278605.1.56388 WP_001278605.1.5639 WP_001278605.1.56390 WP_001278605.1.56392 WP_001278605.1.56399 WP_001278605.1.56402 WP_001278605.1.56436 WP_001278605.1.56439 WP_001278605.1.56446 WP_001278605.1.56457 WP_001278605.1.5646 WP_001278605.1.56469 WP_001278605.1.56481 WP_001278605.1.56489 WP_001278605.1.5649 WP_001278605.1.56491 WP_001278605.1.56501 WP_001278605.1.56502 WP_001278605.1.56513 WP_001278605.1.56523 WP_001278605.1.56528 WP_001278605.1.56543 WP_001278605.1.56554 WP_001278605.1.56571 WP_001278605.1.56573 WP_001278605.1.56586 WP_001278605.1.56650 WP_001278605.1.56662 WP_001278605.1.56680 WP_001278605.1.56689 WP_001278605.1.5670 WP_001278605.1.56704 WP_001278605.1.56713 WP_001278605.1.56714 WP_001278605.1.56721 WP_001278605.1.56742 WP_001278605.1.56776 WP_001278605.1.56777 WP_001278605.1.56786 WP_001278605.1.56787 WP_001278605.1.56789 WP_001278605.1.56799 WP_001278605.1.56821 WP_001278605.1.56830 WP_001278605.1.56835 WP_001278605.1.56846 WP_001278605.1.5685 WP_001278605.1.56871 WP_001278605.1.56882 WP_001278605.1.56885 WP_001278605.1.56908 WP_001278605.1.56932 WP_001278605.1.56933 WP_001278605.1.56934 WP_001278605.1.56936 WP_001278605.1.56937 WP_001278605.1.56941 WP_001278605.1.56951 WP_001278605.1.56978 WP_001278605.1.56980 WP_001278605.1.56992 WP_001278605.1.57011 WP_001278605.1.57032 WP_001278605.1.57045 WP_001278605.1.57051 WP_001278605.1.57068 WP_001278605.1.57071 WP_001278605.1.57072 WP_001278605.1.57079 WP_001278605.1.57086 WP_001278605.1.57100 WP_001278605.1.57124 WP_001278605.1.57150 WP_001278605.1.57159 WP_001278605.1.57180 WP_001278605.1.57181 WP_001278605.1.57182 WP_001278605.1.57185 WP_001278605.1.57197 WP_001278605.1.57202 WP_001278605.1.57213 WP_001278605.1.57216 WP_001278605.1.57222 WP_001278605.1.57254 WP_001278605.1.57266 WP_001278605.1.57269 WP_001278605.1.57278 WP_001278605.1.57280 WP_001278605.1.57281 WP_001278605.1.57319 WP_001278605.1.57348 WP_001278605.1.57349 WP_001278605.1.57386 WP_001278605.1.57395 WP_001278605.1.57401 WP_001278605.1.57403 WP_001278605.1.57410 WP_001278605.1.57414 WP_001278605.1.5742 WP_001278605.1.57432 WP_001278605.1.57438 WP_001278605.1.57451 WP_001278605.1.57453 WP_001278605.1.57466 WP_001278605.1.5748 WP_001278605.1.57487 WP_001278605.1.57492 WP_001278605.1.57517 WP_001278605.1.57538 WP_001278605.1.57539 WP_001278605.1.57550 WP_001278605.1.57558 WP_001278605.1.57574 WP_001278605.1.57588 WP_001278605.1.57608 WP_001278605.1.57610 WP_001278605.1.57628 WP_001278605.1.57629 WP_001278605.1.57634 WP_001278605.1.57638 WP_001278605.1.5764 WP_001278605.1.57646 WP_001278605.1.57659 WP_001278605.1.57663 WP_001278605.1.57669 WP_001278605.1.57719 WP_001278605.1.57738 WP_001278605.1.57812 WP_001278605.1.57814 WP_001278605.1.57832 WP_001278605.1.57836 WP_001278605.1.57846 WP_001278605.1.57851 WP_001278605.1.57854 WP_001278605.1.5786 WP_001278605.1.5787 WP_001278605.1.57898 WP_001278605.1.57903 WP_001278605.1.57904 WP_001278605.1.57920 WP_001278605.1.57951 WP_001278605.1.57975 WP_001278605.1.57982 WP_001278605.1.57983 WP_001278605.1.57994 WP_001278605.1.58001 WP_001278605.1.58009 WP_001278605.1.58022 WP_001278605.1.58038 WP_001278605.1.58045 WP_001278605.1.58048 WP_001278605.1.58057 WP_001278605.1.58060 WP_001278605.1.58080 WP_001278605.1.58092 WP_001278605.1.58094 WP_001278605.1.58097 WP_001278605.1.58098 WP_001278605.1.5810 WP_001278605.1.58107 WP_001278605.1.5812 WP_001278605.1.58136 WP_001278605.1.58143 WP_001278605.1.58146 WP_001278605.1.58163 WP_001278605.1.58169 WP_001278605.1.58172 WP_001278605.1.58206 WP_001278605.1.58226 WP_001278605.1.58232 WP_001278605.1.58233 WP_001278605.1.58238 WP_001278605.1.58244 WP_001278605.1.58267 WP_001278605.1.58289 WP_001278605.1.58292 WP_001278605.1.58316 WP_001278605.1.58336 WP_001278605.1.58340 WP_001278605.1.58345 WP_001278605.1.58368 WP_001278605.1.58371 WP_001278605.1.584 WP_001278605.1.58401 WP_001278605.1.58408 WP_001278605.1.58414 WP_001278605.1.5842 WP_001278605.1.58420 WP_001278605.1.58423 WP_001278605.1.58429 WP_001278605.1.58440 WP_001278605.1.58444 WP_001278605.1.58445 WP_001278605.1.58449 WP_001278605.1.58459 WP_001278605.1.58475 WP_001278605.1.58493 WP_001278605.1.58496 WP_001278605.1.585 WP_001278605.1.58507 WP_001278605.1.58514 WP_001278605.1.5852 WP_001278605.1.58528 WP_001278605.1.58547 WP_001278605.1.58552 WP_001278605.1.58560 WP_001278605.1.58572 WP_001278605.1.58582 WP_001278605.1.58609 WP_001278605.1.58617 WP_001278605.1.58622 WP_001278605.1.58657 WP_001278605.1.58680 WP_001278605.1.58692 WP_001278605.1.58705 WP_001278605.1.58707 WP_001278605.1.58723 WP_001278605.1.58737 WP_001278605.1.58799 WP_001278605.1.58837 WP_001278605.1.58867 WP_001278605.1.58870 WP_001278605.1.58901 WP_001278605.1.58940 WP_001278605.1.58942 WP_001278605.1.58951 WP_001278605.1.58958 WP_001278605.1.58976 WP_001278605.1.58977 WP_001278605.1.58983 WP_001278605.1.58999 WP_001278605.1.59024 WP_001278605.1.59026 WP_001278605.1.59035 WP_001278605.1.59038 WP_001278605.1.59047 WP_001278605.1.59055 WP_001278605.1.5906 WP_001278605.1.59060 WP_001278605.1.59073 WP_001278605.1.59083 WP_001278605.1.59119 WP_001278605.1.59165 WP_001278605.1.59174 WP_001278605.1.59190 WP_001278605.1.59199 WP_001278605.1.59218 WP_001278605.1.59226 WP_001278605.1.59263 WP_001278605.1.5927 WP_001278605.1.59280 WP_001278605.1.59291 WP_001278605.1.59292 WP_001278605.1.59293 WP_001278605.1.59302 WP_001278605.1.59306 WP_001278605.1.59359 WP_001278605.1.59374 WP_001278605.1.59395 WP_001278605.1.59396 WP_001278605.1.59407 WP_001278605.1.59409 WP_001278605.1.59413 WP_001278605.1.5942 WP_001278605.1.59423 WP_001278605.1.59425 WP_001278605.1.59426 WP_001278605.1.59434 WP_001278605.1.59470 WP_001278605.1.59483 WP_001278605.1.59491 WP_001278605.1.59513 WP_001278605.1.59533 WP_001278605.1.59553 WP_001278605.1.59572 WP_001278605.1.59577 WP_001278605.1.59579 WP_001278605.1.59611 WP_001278605.1.59613 WP_001278605.1.59615 WP_001278605.1.59621 WP_001278605.1.5963 WP_001278605.1.59638 WP_001278605.1.5965 WP_001278605.1.59660 WP_001278605.1.59679 WP_001278605.1.59689 WP_001278605.1.59699 WP_001278605.1.597 WP_001278605.1.59714 WP_001278605.1.59717 WP_001278605.1.59730 WP_001278605.1.59733 WP_001278605.1.59737 WP_001278605.1.59745 WP_001278605.1.59748 WP_001278605.1.59756 WP_001278605.1.59781 WP_001278605.1.59782 WP_001278605.1.59788 WP_001278605.1.59791 WP_001278605.1.59793 WP_001278605.1.59815 WP_001278605.1.59823 WP_001278605.1.59836 WP_001278605.1.59838 WP_001278605.1.59853 WP_001278605.1.59855 WP_001278605.1.59858 WP_001278605.1.59894 WP_001278605.1.5990 WP_001278605.1.59900 WP_001278605.1.59905 WP_001278605.1.59912 WP_001278605.1.59914 WP_001278605.1.59931 WP_001278605.1.59959 WP_001278605.1.59970 WP_001278605.1.59980 WP_001278605.1.59981 WP_001278605.1.59989 WP_001278605.1.59998 WP_001278605.1.60005 WP_001278605.1.6002 WP_001278605.1.60023 WP_001278605.1.60031 WP_001278605.1.60042 WP_001278605.1.60043 WP_001278605.1.60048 WP_001278605.1.60067 WP_001278605.1.60070 WP_001278605.1.60095 WP_001278605.1.60096 WP_001278605.1.60110 WP_001278605.1.60117 WP_001278605.1.6013 WP_001278605.1.60133 WP_001278605.1.60151 WP_001278605.1.60186 WP_001278605.1.6022 WP_001278605.1.60225 WP_001278605.1.60228 WP_001278605.1.60235 WP_001278605.1.60246 WP_001278605.1.60304 WP_001278605.1.60325 WP_001278605.1.60337 WP_001278605.1.60342 WP_001278605.1.60343 WP_001278605.1.60350 WP_001278605.1.60373 WP_001278605.1.60374 WP_001278605.1.60387 WP_001278605.1.60411 WP_001278605.1.60436 WP_001278605.1.60443 WP_001278605.1.60453 WP_001278605.1.60457 WP_001278605.1.60461 WP_001278605.1.60477 WP_001278605.1.60491 WP_001278605.1.60498 WP_001278605.1.60505 WP_001278605.1.60544 WP_001278605.1.60550 WP_001278605.1.60555 WP_001278605.1.60559 WP_001278605.1.60567 WP_001278605.1.60570 WP_001278605.1.60576 WP_001278605.1.6059 WP_001278605.1.60591 WP_001278605.1.60599 WP_001278605.1.60606 WP_001278605.1.6061 WP_001278605.1.60613 WP_001278605.1.60614 WP_001278605.1.60630 WP_001278605.1.6064 WP_001278605.1.60644 WP_001278605.1.60647 WP_001278605.1.60654 WP_001278605.1.6066 WP_001278605.1.60671 WP_001278605.1.6068 WP_001278605.1.60684 WP_001278605.1.60698 WP_001278605.1.60717 WP_001278605.1.60732 WP_001278605.1.60744 WP_001278605.1.60761 WP_001278605.1.60764 WP_001278605.1.60771 WP_001278605.1.60805 WP_001278605.1.60816 WP_001278605.1.60826 WP_001278605.1.60832 WP_001278605.1.60835 WP_001278605.1.60847 WP_001278605.1.60872 WP_001278605.1.60895 WP_001278605.1.60901 WP_001278605.1.60921 WP_001278605.1.60925 WP_001278605.1.60927 WP_001278605.1.60935 WP_001278605.1.6094 WP_001278605.1.60974 WP_001278605.1.61005 WP_001278605.1.61006 WP_001278605.1.61008 WP_001278605.1.61035 WP_001278605.1.61039 WP_001278605.1.61046 WP_001278605.1.61058 WP_001278605.1.61096 WP_001278605.1.61097 WP_001278605.1.61099 WP_001278605.1.6110 WP_001278605.1.61102 WP_001278605.1.61108 WP_001278605.1.61112 WP_001278605.1.61121 WP_001278605.1.61132 WP_001278605.1.61148 WP_001278605.1.61170 WP_001278605.1.61174 WP_001278605.1.61175 WP_001278605.1.61181 WP_001278605.1.61183 WP_001278605.1.61186 WP_001278605.1.61223 WP_001278605.1.61225 WP_001278605.1.61241 WP_001278605.1.61245 WP_001278605.1.61253 WP_001278605.1.61268 WP_001278605.1.61284 WP_001278605.1.61292 WP_001278605.1.613 WP_001278605.1.61360 WP_001278605.1.61362 WP_001278605.1.61364 WP_001278605.1.61373 WP_001278605.1.6138 WP_001278605.1.61398 WP_001278605.1.61442 WP_001278605.1.61445 WP_001278605.1.61480 WP_001278605.1.61496 WP_001278605.1.615 WP_001278605.1.61512 WP_001278605.1.61517 WP_001278605.1.61524 WP_001278605.1.61551 WP_001278605.1.61608 WP_001278605.1.61612 WP_001278605.1.61617 WP_001278605.1.61623 WP_001278605.1.61636 WP_001278605.1.61643 WP_001278605.1.61663 WP_001278605.1.61703 WP_001278605.1.61718 WP_001278605.1.61739 WP_001278605.1.61758 WP_001278605.1.61770 WP_001278605.1.61772 WP_001278605.1.61779 WP_001278605.1.61789 WP_001278605.1.618 WP_001278605.1.61806 WP_001278605.1.61822 WP_001278605.1.61835 WP_001278605.1.61853 WP_001278605.1.61858 WP_001278605.1.61874 WP_001278605.1.61893 WP_001278605.1.61926 WP_001278605.1.61939 WP_001278605.1.61948 WP_001278605.1.61949 WP_001278605.1.61955 WP_001278605.1.61957 WP_001278605.1.61966 WP_001278605.1.61985 WP_001278605.1.62038 WP_001278605.1.62041 WP_001278605.1.62043 WP_001278605.1.62091 WP_001278605.1.62099 WP_001278605.1.62102 WP_001278605.1.6212 WP_001278605.1.62135 WP_001278605.1.62157 WP_001278605.1.62182 WP_001278605.1.62236 WP_001278605.1.62262 WP_001278605.1.62264 WP_001278605.1.62266 WP_001278605.1.62273 WP_001278605.1.62282 WP_001278605.1.62290 WP_001278605.1.62296 WP_001278605.1.62303 WP_001278605.1.62322 WP_001278605.1.62337 WP_001278605.1.62348 WP_001278605.1.62358 WP_001278605.1.62424 WP_001278605.1.6245 WP_001278605.1.62454 WP_001278605.1.62460 WP_001278605.1.62480 WP_001278605.1.62481 WP_001278605.1.62503 WP_001278605.1.62507 WP_001278605.1.62513 WP_001278605.1.62514 WP_001278605.1.62529 WP_001278605.1.62541 WP_001278605.1.62555 WP_001278605.1.62586 WP_001278605.1.6261 WP_001278605.1.62612 WP_001278605.1.62631 WP_001278605.1.62642 WP_001278605.1.62646 WP_001278605.1.62668 WP_001278605.1.62675 WP_001278605.1.62681 WP_001278605.1.62714 WP_001278605.1.62735 WP_001278605.1.62750 WP_001278605.1.62762 WP_001278605.1.62769 WP_001278605.1.62780 WP_001278605.1.62784 WP_001278605.1.62787 WP_001278605.1.62788 WP_001278605.1.62802 WP_001278605.1.62812 WP_001278605.1.62818 WP_001278605.1.62819 WP_001278605.1.6282 WP_001278605.1.62840 WP_001278605.1.62843 WP_001278605.1.62850 WP_001278605.1.62851 WP_001278605.1.62866 WP_001278605.1.62885 WP_001278605.1.62888 WP_001278605.1.6293 WP_001278605.1.62931 WP_001278605.1.62951 WP_001278605.1.62959 WP_001278605.1.62973 WP_001278605.1.62989 WP_001278605.1.6299 WP_001278605.1.62992 WP_001278605.1.63023 WP_001278605.1.6307 WP_001278605.1.63078 WP_001278605.1.63113 WP_001278605.1.63167 WP_001278605.1.63177 WP_001278605.1.63189 WP_001278605.1.6323 WP_001278605.1.63246 WP_001278605.1.63285 WP_001278605.1.63287 WP_001278605.1.63305 WP_001278605.1.6331 WP_001278605.1.63310 WP_001278605.1.63330 WP_001278605.1.6334 WP_001278605.1.63350 WP_001278605.1.6337 WP_001278605.1.63370 WP_001278605.1.63374 WP_001278605.1.63393 WP_001278605.1.63419 WP_001278605.1.63433 WP_001278605.1.63435 WP_001278605.1.63437 WP_001278605.1.63445 WP_001278605.1.63453 WP_001278605.1.63465 WP_001278605.1.63466 WP_001278605.1.63467 WP_001278605.1.63470 WP_001278605.1.63478 WP_001278605.1.6348 WP_001278605.1.63484 WP_001278605.1.63487 WP_001278605.1.63491 WP_001278605.1.63496 WP_001278605.1.63536 WP_001278605.1.63554 WP_001278605.1.63556 WP_001278605.1.63563 WP_001278605.1.63576 WP_001278605.1.63586 WP_001278605.1.63602 WP_001278605.1.63604 WP_001278605.1.63608 WP_001278605.1.63612 WP_001278605.1.63615 WP_001278605.1.6364 WP_001278605.1.63666 WP_001278605.1.63679 WP_001278605.1.63683 WP_001278605.1.63703 WP_001278605.1.63721 WP_001278605.1.63746 WP_001278605.1.63800 WP_001278605.1.63810 WP_001278605.1.63814 WP_001278605.1.63821 WP_001278605.1.63856 WP_001278605.1.63871 WP_001278605.1.63872 WP_001278605.1.63944 WP_001278605.1.63957 WP_001278605.1.63964 WP_001278605.1.63969 WP_001278605.1.63990 WP_001278605.1.64008 WP_001278605.1.64014 WP_001278605.1.64030 WP_001278605.1.64040 WP_001278605.1.64045 WP_001278605.1.64053 WP_001278605.1.64074 WP_001278605.1.64080 WP_001278605.1.64086 WP_001278605.1.64110 WP_001278605.1.64138 WP_001278605.1.64150 WP_001278605.1.64153 WP_001278605.1.6416 WP_001278605.1.64161 WP_001278605.1.64165 WP_001278605.1.64175 WP_001278605.1.64180 WP_001278605.1.64190 WP_001278605.1.64193 WP_001278605.1.64280 WP_001278605.1.64285 WP_001278605.1.64286 WP_001278605.1.643 WP_001278605.1.6431 WP_001278605.1.64312 WP_001278605.1.64321 WP_001278605.1.64330 WP_001278605.1.64337 WP_001278605.1.64353 WP_001278605.1.64355 WP_001278605.1.64356 WP_001278605.1.64371 WP_001278605.1.64380 WP_001278605.1.64391 WP_001278605.1.6441 WP_001278605.1.64417 WP_001278605.1.64437 WP_001278605.1.64438 WP_001278605.1.6444 WP_001278605.1.64448 WP_001278605.1.6445 WP_001278605.1.64458 WP_001278605.1.6446 WP_001278605.1.64519 WP_001278605.1.64520 WP_001278605.1.64528 WP_001278605.1.64540 WP_001278605.1.64547 WP_001278605.1.64563 WP_001278605.1.64621 WP_001278605.1.64634 WP_001278605.1.64657 WP_001278605.1.64670 WP_001278605.1.6469 WP_001278605.1.64693 WP_001278605.1.64695 WP_001278605.1.647 WP_001278605.1.64707 WP_001278605.1.64712 WP_001278605.1.64746 WP_001278605.1.64749 WP_001278605.1.64784 WP_001278605.1.64789 WP_001278605.1.64793 WP_001278605.1.64821 WP_001278605.1.64840 WP_001278605.1.64866 WP_001278605.1.64875 WP_001278605.1.64881 WP_001278605.1.64895 WP_001278605.1.64901 WP_001278605.1.64912 WP_001278605.1.64926 WP_001278605.1.64930 WP_001278605.1.64939 WP_001278605.1.64946 WP_001278605.1.64970 WP_001278605.1.6499 WP_001278605.1.64990 WP_001278605.1.6500 WP_001278605.1.65023 WP_001278605.1.65035 WP_001278605.1.65040 WP_001278605.1.65056 WP_001278605.1.65061 WP_001278605.1.65084 WP_001278605.1.65085 WP_001278605.1.65097 WP_001278605.1.651 WP_001278605.1.65104 WP_001278605.1.6511 WP_001278605.1.65110 WP_001278605.1.65114 WP_001278605.1.65116 WP_001278605.1.65118 WP_001278605.1.65122 WP_001278605.1.65135 WP_001278605.1.65151 WP_001278605.1.65155 WP_001278605.1.6516 WP_001278605.1.65179 WP_001278605.1.65192 WP_001278605.1.65194 WP_001278605.1.65206 WP_001278605.1.65240 WP_001278605.1.65256 WP_001278605.1.6527 WP_001278605.1.65271 WP_001278605.1.65286 WP_001278605.1.65296 WP_001278605.1.65305 WP_001278605.1.65353 WP_001278605.1.65355 WP_001278605.1.65364 WP_001278605.1.65366 WP_001278605.1.6537 WP_001278605.1.65370 WP_001278605.1.65372 WP_001278605.1.654 WP_001278605.1.65405 WP_001278605.1.65408 WP_001278605.1.65413 WP_001278605.1.65415 WP_001278605.1.65456 WP_001278605.1.65484 WP_001278605.1.65493 WP_001278605.1.6553 WP_001278605.1.65531 WP_001278605.1.65546 WP_001278605.1.65565 WP_001278605.1.65571 WP_001278605.1.65581 WP_001278605.1.65596 WP_001278605.1.65606 WP_001278605.1.6563 WP_001278605.1.65667 WP_001278605.1.65672 WP_001278605.1.65677 WP_001278605.1.65708 WP_001278605.1.65714 WP_001278605.1.65749 WP_001278605.1.6576 WP_001278605.1.65762 WP_001278605.1.65834 WP_001278605.1.6587 WP_001278605.1.65875 WP_001278605.1.65898 WP_001278605.1.65912 WP_001278605.1.65954 WP_001278605.1.65957 WP_001278605.1.65961 WP_001278605.1.65962 WP_001278605.1.65963 WP_001278605.1.65976 WP_001278605.1.65978 WP_001278605.1.65988 WP_001278605.1.6599 WP_001278605.1.65991 WP_001278605.1.66001 WP_001278605.1.66007 WP_001278605.1.66016 WP_001278605.1.66017 WP_001278605.1.66022 WP_001278605.1.66033 WP_001278605.1.6604 WP_001278605.1.66044 WP_001278605.1.66050 WP_001278605.1.66059 WP_001278605.1.66071 WP_001278605.1.6609 WP_001278605.1.66094 WP_001278605.1.66100 WP_001278605.1.66102 WP_001278605.1.66104 WP_001278605.1.66105 WP_001278605.1.66121 WP_001278605.1.66127 WP_001278605.1.66161 WP_001278605.1.6618 WP_001278605.1.66181 WP_001278605.1.66187 WP_001278605.1.66197 WP_001278605.1.6622 WP_001278605.1.66251 WP_001278605.1.66255 WP_001278605.1.66264 WP_001278605.1.66280 WP_001278605.1.66288 WP_001278605.1.66290 WP_001278605.1.66295 WP_001278605.1.66327 WP_001278605.1.66335 WP_001278605.1.6635 WP_001278605.1.66376 WP_001278605.1.66387 WP_001278605.1.66389 WP_001278605.1.66392 WP_001278605.1.66395 WP_001278605.1.66412 WP_001278605.1.66421 WP_001278605.1.66432 WP_001278605.1.66448 WP_001278605.1.6645 WP_001278605.1.66501 WP_001278605.1.66511 WP_001278605.1.66523 WP_001278605.1.66531 WP_001278605.1.6654 WP_001278605.1.66550 WP_001278605.1.66559 WP_001278605.1.66566 WP_001278605.1.66579 WP_001278605.1.66624 WP_001278605.1.66644 WP_001278605.1.6666 WP_001278605.1.66667 WP_001278605.1.66668 WP_001278605.1.66700 WP_001278605.1.66706 WP_001278605.1.66708 WP_001278605.1.66719 WP_001278605.1.66727 WP_001278605.1.66751 WP_001278605.1.66758 WP_001278605.1.6676 WP_001278605.1.66783 WP_001278605.1.66787 WP_001278605.1.66791 WP_001278605.1.66794 WP_001278605.1.66795 WP_001278605.1.66796 WP_001278605.1.66849 WP_001278605.1.66873 WP_001278605.1.66922 WP_001278605.1.66926 WP_001278605.1.66933 WP_001278605.1.66948 WP_001278605.1.66975 WP_001278605.1.66978 WP_001278605.1.6698 WP_001278605.1.66984 WP_001278605.1.6701 WP_001278605.1.67018 WP_001278605.1.67021 WP_001278605.1.67022 WP_001278605.1.67026 WP_001278605.1.67029 WP_001278605.1.67035 WP_001278605.1.67047 WP_001278605.1.67055 WP_001278605.1.6706 WP_001278605.1.67073 WP_001278605.1.67102 WP_001278605.1.67120 WP_001278605.1.67132 WP_001278605.1.67136 WP_001278605.1.67137 WP_001278605.1.67149 WP_001278605.1.67150 WP_001278605.1.67153 WP_001278605.1.67158 WP_001278605.1.67164 WP_001278605.1.67174 WP_001278605.1.67193 WP_001278605.1.67194 WP_001278605.1.67200 WP_001278605.1.67209 WP_001278605.1.67210 WP_001278605.1.67214 WP_001278605.1.6723 WP_001278605.1.67258 WP_001278605.1.67272 WP_001278605.1.67278 WP_001278605.1.67284 WP_001278605.1.67293 WP_001278605.1.6735 WP_001278605.1.67373 WP_001278605.1.67383 WP_001278605.1.67412 WP_001278605.1.67415 WP_001278605.1.67427 WP_001278605.1.67446 WP_001278605.1.67451 WP_001278605.1.67452 WP_001278605.1.67454 WP_001278605.1.67456 WP_001278605.1.67462 WP_001278605.1.67464 WP_001278605.1.67467 WP_001278605.1.67468 WP_001278605.1.67495 WP_001278605.1.67522 WP_001278605.1.67533 WP_001278605.1.67538 WP_001278605.1.67549 WP_001278605.1.67553 WP_001278605.1.67581 WP_001278605.1.67590 WP_001278605.1.67606 WP_001278605.1.67663 WP_001278605.1.67669 WP_001278605.1.67676 WP_001278605.1.67681 WP_001278605.1.67685 WP_001278605.1.6769 WP_001278605.1.67690 WP_001278605.1.67704 WP_001278605.1.67724 WP_001278605.1.67726 WP_001278605.1.67737 WP_001278605.1.67753 WP_001278605.1.67758 WP_001278605.1.67760 WP_001278605.1.67775 WP_001278605.1.67780 WP_001278605.1.67786 WP_001278605.1.67787 WP_001278605.1.67788 WP_001278605.1.678 WP_001278605.1.67802 WP_001278605.1.67810 WP_001278605.1.67841 WP_001278605.1.67853 WP_001278605.1.67861 WP_001278605.1.67891 WP_001278605.1.67894 WP_001278605.1.67901 WP_001278605.1.6793 WP_001278605.1.67938 WP_001278605.1.67971 WP_001278605.1.67975 WP_001278605.1.67984 WP_001278605.1.67990 WP_001278605.1.67992 WP_001278605.1.67999 WP_001278605.1.68008 WP_001278605.1.68011 WP_001278605.1.68012 WP_001278605.1.6802 WP_001278605.1.68025 WP_001278605.1.6803 WP_001278605.1.68039 WP_001278605.1.68052 WP_001278605.1.68053 WP_001278605.1.68058 WP_001278605.1.68059 WP_001278605.1.68063 WP_001278605.1.68067 WP_001278605.1.68069 WP_001278605.1.68070 WP_001278605.1.68071 WP_001278605.1.68079 WP_001278605.1.68096 WP_001278605.1.6810 WP_001278605.1.68108 WP_001278605.1.68126 WP_001278605.1.68138 WP_001278605.1.6814 WP_001278605.1.68145 WP_001278605.1.68157 WP_001278605.1.68170 WP_001278605.1.68175 WP_001278605.1.68177 WP_001278605.1.682 WP_001278605.1.68200 WP_001278605.1.68215 WP_001278605.1.68231 WP_001278605.1.68241 WP_001278605.1.68255 WP_001278605.1.68271 WP_001278605.1.68278 WP_001278605.1.68279 WP_001278605.1.68281 WP_001278605.1.68283 WP_001278605.1.68292 WP_001278605.1.68300 WP_001278605.1.68336 WP_001278605.1.68341 WP_001278605.1.68347 WP_001278605.1.68362 WP_001278605.1.68369 WP_001278605.1.68372 WP_001278605.1.68395 WP_001278605.1.68396 WP_001278605.1.68411 WP_001278605.1.68441 WP_001278605.1.68442 WP_001278605.1.68482 WP_001278605.1.68490 WP_001278605.1.68493 WP_001278605.1.68523 WP_001278605.1.68524 WP_001278605.1.68566 WP_001278605.1.68572 WP_001278605.1.68584 WP_001278605.1.6859 WP_001278605.1.68598 WP_001278605.1.6860 WP_001278605.1.68609 WP_001278605.1.68630 WP_001278605.1.68632 WP_001278605.1.68635 WP_001278605.1.68673 WP_001278605.1.68678 WP_001278605.1.68679 WP_001278605.1.68695 WP_001278605.1.68697 WP_001278605.1.68701 WP_001278605.1.68711 WP_001278605.1.68735 WP_001278605.1.68750 WP_001278605.1.68751 WP_001278605.1.68752 WP_001278605.1.6877 WP_001278605.1.68793 WP_001278605.1.68795 WP_001278605.1.68797 WP_001278605.1.6880 WP_001278605.1.68801 WP_001278605.1.68838 WP_001278605.1.68847 WP_001278605.1.68865 WP_001278605.1.6887 WP_001278605.1.68873 WP_001278605.1.68877 WP_001278605.1.68880 WP_001278605.1.68911 WP_001278605.1.68915 WP_001278605.1.6892 WP_001278605.1.68924 WP_001278605.1.68936 WP_001278605.1.68942 WP_001278605.1.68952 WP_001278605.1.68956 WP_001278605.1.68961 WP_001278605.1.6897 WP_001278605.1.68989 WP_001278605.1.68995 WP_001278605.1.69033 WP_001278605.1.69039 WP_001278605.1.69054 WP_001278605.1.69098 WP_001278605.1.69126 WP_001278605.1.69127 WP_001278605.1.69144 WP_001278605.1.69158 WP_001278605.1.6916 WP_001278605.1.69160 WP_001278605.1.6919 WP_001278605.1.69192 WP_001278605.1.6921 WP_001278605.1.69221 WP_001278605.1.6923 WP_001278605.1.69247 WP_001278605.1.69258 WP_001278605.1.69261 WP_001278605.1.6929 WP_001278605.1.69303 WP_001278605.1.69305 WP_001278605.1.69327 WP_001278605.1.69341 WP_001278605.1.69350 WP_001278605.1.69351 WP_001278605.1.69382 WP_001278605.1.69390 WP_001278605.1.694 WP_001278605.1.69404 WP_001278605.1.69438 WP_001278605.1.69441 WP_001278605.1.6945 WP_001278605.1.69450 WP_001278605.1.69472 WP_001278605.1.69473 WP_001278605.1.69502 WP_001278605.1.69506 WP_001278605.1.69537 WP_001278605.1.69551 WP_001278605.1.69569 WP_001278605.1.69583 WP_001278605.1.69589 WP_001278605.1.69593 WP_001278605.1.69596 WP_001278605.1.69605 WP_001278605.1.69643 WP_001278605.1.69646 WP_001278605.1.69649 WP_001278605.1.69655 WP_001278605.1.69689 WP_001278605.1.697 WP_001278605.1.69716 WP_001278605.1.69730 WP_001278605.1.69735 WP_001278605.1.69780 WP_001278605.1.69803 WP_001278605.1.69810 WP_001278605.1.69818 WP_001278605.1.69831 WP_001278605.1.69832 WP_001278605.1.69868 WP_001278605.1.69872 WP_001278605.1.69887 WP_001278605.1.69896 WP_001278605.1.6993 WP_001278605.1.69963 WP_001278605.1.69972 WP_001278605.1.69979 WP_001278605.1.69999 WP_001278605.1.7001 WP_001278605.1.70041 WP_001278605.1.70063 WP_001278605.1.70081 WP_001278605.1.701 WP_001278605.1.70123 WP_001278605.1.70125 WP_001278605.1.7013 WP_001278605.1.70149 WP_001278605.1.7015 WP_001278605.1.70190 WP_001278605.1.70191 WP_001278605.1.70200 WP_001278605.1.70213 WP_001278605.1.70230 WP_001278605.1.70251 WP_001278605.1.70256 WP_001278605.1.70299 WP_001278605.1.70300 WP_001278605.1.70337 WP_001278605.1.70341 WP_001278605.1.70357 WP_001278605.1.70370 WP_001278605.1.70386 WP_001278605.1.70407 WP_001278605.1.70408 WP_001278605.1.70414 WP_001278605.1.70477 WP_001278605.1.70492 WP_001278605.1.7050 WP_001278605.1.70509 WP_001278605.1.70517 WP_001278605.1.7052 WP_001278605.1.70539 WP_001278605.1.70563 WP_001278605.1.70576 WP_001278605.1.70578 WP_001278605.1.70582 WP_001278605.1.70592 WP_001278605.1.70597 WP_001278605.1.70600 WP_001278605.1.70619 WP_001278605.1.70655 WP_001278605.1.70656 WP_001278605.1.70686 WP_001278605.1.70694 WP_001278605.1.70698 WP_001278605.1.70705 WP_001278605.1.70713 WP_001278605.1.70723 WP_001278605.1.70728 WP_001278605.1.70745 WP_001278605.1.70747 WP_001278605.1.70748 WP_001278605.1.70767 WP_001278605.1.70787 WP_001278605.1.70794 WP_001278605.1.70801 WP_001278605.1.70803 WP_001278605.1.70880 WP_001278605.1.70896 WP_001278605.1.7090 WP_001278605.1.70900 WP_001278605.1.70952 WP_001278605.1.70967 WP_001278605.1.71003 WP_001278605.1.7102 WP_001278605.1.71024 WP_001278605.1.71037 WP_001278605.1.71042 WP_001278605.1.71062 WP_001278605.1.71099 WP_001278605.1.71109 WP_001278605.1.71113 WP_001278605.1.71134 WP_001278605.1.71139 WP_001278605.1.71144 WP_001278605.1.71147 WP_001278605.1.71149 WP_001278605.1.71158 WP_001278605.1.71159 WP_001278605.1.71162 WP_001278605.1.71170 WP_001278605.1.71176 WP_001278605.1.71183 WP_001278605.1.71192 WP_001278605.1.71199 WP_001278605.1.71205 WP_001278605.1.7121 WP_001278605.1.71221 WP_001278605.1.71223 WP_001278605.1.71225 WP_001278605.1.71226 WP_001278605.1.71229 WP_001278605.1.71264 WP_001278605.1.71269 WP_001278605.1.71272 WP_001278605.1.71273 WP_001278605.1.71275 WP_001278605.1.71285 WP_001278605.1.71287 WP_001278605.1.71294 WP_001278605.1.71311 WP_001278605.1.71312 WP_001278605.1.71315 WP_001278605.1.71323 WP_001278605.1.71339 WP_001278605.1.71354 WP_001278605.1.71397 WP_001278605.1.71403 WP_001278605.1.71405 WP_001278605.1.71409 WP_001278605.1.71421 WP_001278605.1.71423 WP_001278605.1.71448 WP_001278605.1.7147 WP_001278605.1.71480 WP_001278605.1.71522 WP_001278605.1.71537 WP_001278605.1.71538 WP_001278605.1.71540 WP_001278605.1.71560 WP_001278605.1.71562 WP_001278605.1.71563 WP_001278605.1.71603 WP_001278605.1.71607 WP_001278605.1.71632 WP_001278605.1.71680 WP_001278605.1.71690 WP_001278605.1.71695 WP_001278605.1.71712 WP_001278605.1.71724 WP_001278605.1.71732 WP_001278605.1.71757 WP_001278605.1.71783 WP_001278605.1.71830 WP_001278605.1.71832 WP_001278605.1.71837 WP_001278605.1.71840 WP_001278605.1.71855 WP_001278605.1.71856 WP_001278605.1.71874 WP_001278605.1.71912 WP_001278605.1.71922 WP_001278605.1.71938 WP_001278605.1.71939 WP_001278605.1.71940 WP_001278605.1.71944 WP_001278605.1.71945 WP_001278605.1.71967 WP_001278605.1.71972 WP_001278605.1.71975 WP_001278605.1.71987 WP_001278605.1.71993 WP_001278605.1.71995 WP_001278605.1.72013 WP_001278605.1.72016 WP_001278605.1.72021 WP_001278605.1.72028 WP_001278605.1.72033 WP_001278605.1.72048 WP_001278605.1.7205 WP_001278605.1.72053 WP_001278605.1.72054 WP_001278605.1.72066 WP_001278605.1.72090 WP_001278605.1.72098 WP_001278605.1.7210 WP_001278605.1.72117 WP_001278605.1.72120 WP_001278605.1.72125 WP_001278605.1.72126 WP_001278605.1.72141 WP_001278605.1.72153 WP_001278605.1.72155 WP_001278605.1.72157 WP_001278605.1.72161 WP_001278605.1.72162 WP_001278605.1.72180 WP_001278605.1.72184 WP_001278605.1.72186 WP_001278605.1.72208 WP_001278605.1.72212 WP_001278605.1.72237 WP_001278605.1.72240 WP_001278605.1.72248 WP_001278605.1.7225 WP_001278605.1.72258 WP_001278605.1.72261 WP_001278605.1.72262 WP_001278605.1.72270 WP_001278605.1.72279 WP_001278605.1.72290 WP_001278605.1.72293 WP_001278605.1.72298 WP_001278605.1.723 WP_001278605.1.72316 WP_001278605.1.72322 WP_001278605.1.72337 WP_001278605.1.72342 WP_001278605.1.72352 WP_001278605.1.72359 WP_001278605.1.72362 WP_001278605.1.72388 WP_001278605.1.72391 WP_001278605.1.72392 WP_001278605.1.72397 WP_001278605.1.72414 WP_001278605.1.72425 WP_001278605.1.72427 WP_001278605.1.72431 WP_001278605.1.72436 WP_001278605.1.72449 WP_001278605.1.72469 WP_001278605.1.72485 WP_001278605.1.72493 WP_001278605.1.72507 WP_001278605.1.72511 WP_001278605.1.72521 WP_001278605.1.72522 WP_001278605.1.72535 WP_001278605.1.72537 WP_001278605.1.72544 WP_001278605.1.72551 WP_001278605.1.72574 WP_001278605.1.72582 WP_001278605.1.72588 WP_001278605.1.72593 WP_001278605.1.72596 WP_001278605.1.72599 WP_001278605.1.72606 WP_001278605.1.72608 WP_001278605.1.72614 WP_001278605.1.72615 WP_001278605.1.72616 WP_001278605.1.72619 WP_001278605.1.72641 WP_001278605.1.72643 WP_001278605.1.72651 WP_001278605.1.72652 WP_001278605.1.72663 WP_001278605.1.72694 WP_001278605.1.72695 WP_001278605.1.72700 WP_001278605.1.72706 WP_001278605.1.72725 WP_001278605.1.72729 WP_001278605.1.72738 WP_001278605.1.72745 WP_001278605.1.72747 WP_001278605.1.72748 WP_001278605.1.72751 WP_001278605.1.72758 WP_001278605.1.72764 WP_001278605.1.7277 WP_001278605.1.72778 WP_001278605.1.72804 WP_001278605.1.72806 WP_001278605.1.7281 WP_001278605.1.72837 WP_001278605.1.72857 WP_001278605.1.72858 WP_001278605.1.72860 WP_001278605.1.72869 WP_001278605.1.72893 WP_001278605.1.7291 WP_001278605.1.72910 WP_001278605.1.72913 WP_001278605.1.72947 WP_001278605.1.72950 WP_001278605.1.72956 WP_001278605.1.72962 WP_001278605.1.72998 WP_001278605.1.73000 WP_001278605.1.73010 WP_001278605.1.73015 WP_001278605.1.73032 WP_001278605.1.73039 WP_001278605.1.73061 WP_001278605.1.7307 WP_001278605.1.73072 WP_001278605.1.73075 WP_001278605.1.73085 WP_001278605.1.7309 WP_001278605.1.73094 WP_001278605.1.73126 WP_001278605.1.73129 WP_001278605.1.73193 WP_001278605.1.73197 WP_001278605.1.73215 WP_001278605.1.73217 WP_001278605.1.73230 WP_001278605.1.73239 WP_001278605.1.73243 WP_001278605.1.73249 WP_001278605.1.73251 WP_001278605.1.73257 WP_001278605.1.73259 WP_001278605.1.73277 WP_001278605.1.73278 WP_001278605.1.73283 WP_001278605.1.73291 WP_001278605.1.73292 WP_001278605.1.73295 WP_001278605.1.73333 WP_001278605.1.73340 WP_001278605.1.73343 WP_001278605.1.73344 WP_001278605.1.73349 WP_001278605.1.73385 WP_001278605.1.73393 WP_001278605.1.73428 WP_001278605.1.73430 WP_001278605.1.7345 WP_001278605.1.73468 WP_001278605.1.73486 WP_001278605.1.7349 WP_001278605.1.73498 WP_001278605.1.73524 WP_001278605.1.73565 WP_001278605.1.73572 WP_001278605.1.73592 WP_001278605.1.73604 WP_001278605.1.73626 WP_001278605.1.73631 WP_001278605.1.73652 WP_001278605.1.73663 WP_001278605.1.73700 WP_001278605.1.73709 WP_001278605.1.73717 WP_001278605.1.73743 WP_001278605.1.73748 WP_001278605.1.7376 WP_001278605.1.73783 WP_001278605.1.73785 WP_001278605.1.73797 WP_001278605.1.73801 WP_001278605.1.73807 WP_001278605.1.73811 WP_001278605.1.73835 WP_001278605.1.73843 WP_001278605.1.73844 WP_001278605.1.73846 WP_001278605.1.73859 WP_001278605.1.73882 WP_001278605.1.73897 WP_001278605.1.73908 WP_001278605.1.7392 WP_001278605.1.73934 WP_001278605.1.73942 WP_001278605.1.73968 WP_001278605.1.73980 WP_001278605.1.73992 WP_001278605.1.73995 WP_001278605.1.73996 WP_001278605.1.74032 WP_001278605.1.74041 WP_001278605.1.74045 WP_001278605.1.74046 WP_001278605.1.74051 WP_001278605.1.74053 WP_001278605.1.7407 WP_001278605.1.74123 WP_001278605.1.7413 WP_001278605.1.74156 WP_001278605.1.74184 WP_001278605.1.74185 WP_001278605.1.74213 WP_001278605.1.74223 WP_001278605.1.7424 WP_001278605.1.74243 WP_001278605.1.7425 WP_001278605.1.74251 WP_001278605.1.74267 WP_001278605.1.7429 WP_001278605.1.74294 WP_001278605.1.74309 WP_001278605.1.74358 WP_001278605.1.74365 WP_001278605.1.74367 WP_001278605.1.744 WP_001278605.1.74423 WP_001278605.1.74426 WP_001278605.1.74431 WP_001278605.1.74444 WP_001278605.1.74445 WP_001278605.1.7446 WP_001278605.1.74465 WP_001278605.1.74478 WP_001278605.1.74491 WP_001278605.1.74501 WP_001278605.1.74509 WP_001278605.1.74513 WP_001278605.1.74520 WP_001278605.1.74521 WP_001278605.1.74528 WP_001278605.1.74532 WP_001278605.1.74536 WP_001278605.1.74549 WP_001278605.1.74557 WP_001278605.1.74574 WP_001278605.1.7461 WP_001278605.1.74611 WP_001278605.1.74623 WP_001278605.1.74624 WP_001278605.1.74625 WP_001278605.1.74631 WP_001278605.1.74652 WP_001278605.1.74670 WP_001278605.1.74682 WP_001278605.1.74687 WP_001278605.1.74688 WP_001278605.1.74689 WP_001278605.1.74691 WP_001278605.1.74705 WP_001278605.1.7471 WP_001278605.1.74713 WP_001278605.1.74716 WP_001278605.1.74720 WP_001278605.1.74735 WP_001278605.1.7475 WP_001278605.1.74752 WP_001278605.1.74765 WP_001278605.1.74767 WP_001278605.1.7478 WP_001278605.1.7479 WP_001278605.1.74793 WP_001278605.1.74811 WP_001278605.1.74828 WP_001278605.1.74844 WP_001278605.1.74852 WP_001278605.1.74854 WP_001278605.1.74860 WP_001278605.1.74867 WP_001278605.1.74873 WP_001278605.1.74879 WP_001278605.1.74880 WP_001278605.1.74885 WP_001278605.1.74889 WP_001278605.1.74895 WP_001278605.1.74904 WP_001278605.1.74914 WP_001278605.1.74915 WP_001278605.1.74962 WP_001278605.1.74975 WP_001278605.1.74993 WP_001278605.1.74998 WP_001278605.1.75003 WP_001278605.1.75021 WP_001278605.1.75029 WP_001278605.1.75030 WP_001278605.1.75050 WP_001278605.1.75087 WP_001278605.1.75100 WP_001278605.1.75112 WP_001278605.1.75118 WP_001278605.1.75124 WP_001278605.1.75136 WP_001278605.1.75138 WP_001278605.1.75139 WP_001278605.1.75143 WP_001278605.1.75145 WP_001278605.1.75149 WP_001278605.1.75155 WP_001278605.1.7516 WP_001278605.1.75164 WP_001278605.1.75181 WP_001278605.1.75209 WP_001278605.1.75218 WP_001278605.1.75219 WP_001278605.1.75221 WP_001278605.1.75228 WP_001278605.1.75243 WP_001278605.1.75247 WP_001278605.1.75248 WP_001278605.1.75254 WP_001278605.1.75270 WP_001278605.1.75272 WP_001278605.1.75306 WP_001278605.1.7536 WP_001278605.1.75360 WP_001278605.1.75367 WP_001278605.1.75382 WP_001278605.1.7539 WP_001278605.1.75419 WP_001278605.1.75428 WP_001278605.1.75435 WP_001278605.1.75465 WP_001278605.1.75491 WP_001278605.1.75505 WP_001278605.1.75507 WP_001278605.1.75515 WP_001278605.1.75529 WP_001278605.1.75536 WP_001278605.1.75537 WP_001278605.1.75557 WP_001278605.1.75568 WP_001278605.1.75577 WP_001278605.1.75588 WP_001278605.1.75594 WP_001278605.1.75602 WP_001278605.1.75612 WP_001278605.1.75629 WP_001278605.1.75644 WP_001278605.1.75653 WP_001278605.1.75672 WP_001278605.1.75676 WP_001278605.1.75679 WP_001278605.1.75687 WP_001278605.1.75694 WP_001278605.1.75696 WP_001278605.1.75698 WP_001278605.1.75699 WP_001278605.1.75725 WP_001278605.1.75735 WP_001278605.1.75758 WP_001278605.1.75767 WP_001278605.1.75786 WP_001278605.1.75803 WP_001278605.1.75808 WP_001278605.1.7583 WP_001278605.1.75839 WP_001278605.1.75892 WP_001278605.1.75918 WP_001278605.1.75922 WP_001278605.1.7597 WP_001278605.1.75973 WP_001278605.1.75983 WP_001278605.1.75989 WP_001278605.1.75995 WP_001278605.1.75999 WP_001278605.1.76005 WP_001278605.1.76009 WP_001278605.1.76019 WP_001278605.1.7603 WP_001278605.1.76030 WP_001278605.1.76036 WP_001278605.1.76039 WP_001278605.1.76054 WP_001278605.1.76057 WP_001278605.1.7608 WP_001278605.1.76087 WP_001278605.1.76089 WP_001278605.1.76103 WP_001278605.1.76118 WP_001278605.1.76119 WP_001278605.1.76129 WP_001278605.1.7613 WP_001278605.1.76152 WP_001278605.1.7617 WP_001278605.1.76184 WP_001278605.1.76189 WP_001278605.1.76194 WP_001278605.1.76196 WP_001278605.1.76211 WP_001278605.1.76237 WP_001278605.1.76268 WP_001278605.1.76269 WP_001278605.1.76305 WP_001278605.1.76335 WP_001278605.1.76361 WP_001278605.1.7637 WP_001278605.1.76376 WP_001278605.1.76384 WP_001278605.1.76390 WP_001278605.1.76407 WP_001278605.1.76446 WP_001278605.1.76447 WP_001278605.1.76448 WP_001278605.1.76452 WP_001278605.1.76460 WP_001278605.1.76462 WP_001278605.1.76466 WP_001278605.1.76469 WP_001278605.1.76477 WP_001278605.1.76504 WP_001278605.1.76542 WP_001278605.1.76544 WP_001278605.1.76547 WP_001278605.1.76562 WP_001278605.1.76595 WP_001278605.1.76596 WP_001278605.1.7661 WP_001278605.1.76612 WP_001278605.1.76619 WP_001278605.1.76643 WP_001278605.1.76656 WP_001278605.1.76660 WP_001278605.1.76697 WP_001278605.1.76701 WP_001278605.1.76705 WP_001278605.1.76707 WP_001278605.1.76712 WP_001278605.1.76751 WP_001278605.1.76759 WP_001278605.1.7680 WP_001278605.1.76815 WP_001278605.1.76827 WP_001278605.1.76831 WP_001278605.1.76840 WP_001278605.1.76863 WP_001278605.1.76884 WP_001278605.1.7689 WP_001278605.1.76909 WP_001278605.1.76918 WP_001278605.1.76933 WP_001278605.1.76948 WP_001278605.1.76957 WP_001278605.1.76961 WP_001278605.1.76965 WP_001278605.1.76966 WP_001278605.1.7699 WP_001278605.1.76994 WP_001278605.1.77007 WP_001278605.1.77015 WP_001278605.1.77022 WP_001278605.1.77036 WP_001278605.1.77042 WP_001278605.1.77057 WP_001278605.1.77070 WP_001278605.1.77081 WP_001278605.1.77099 WP_001278605.1.771 WP_001278605.1.77109 WP_001278605.1.77120 WP_001278605.1.77128 WP_001278605.1.77134 WP_001278605.1.77147 WP_001278605.1.77162 WP_001278605.1.77163 WP_001278605.1.77173 WP_001278605.1.77175 WP_001278605.1.77198 WP_001278605.1.77200 WP_001278605.1.77204 WP_001278605.1.77214 WP_001278605.1.77224 WP_001278605.1.77239 WP_001278605.1.77253 WP_001278605.1.77255 WP_001278605.1.77258 WP_001278605.1.77275 WP_001278605.1.7728 WP_001278605.1.77284 WP_001278605.1.77288 WP_001278605.1.7729 WP_001278605.1.77290 WP_001278605.1.77291 WP_001278605.1.77296 WP_001278605.1.7731 WP_001278605.1.77326 WP_001278605.1.77341 WP_001278605.1.77358 WP_001278605.1.77391 WP_001278605.1.77392 WP_001278605.1.77408 WP_001278605.1.77419 WP_001278605.1.77432 WP_001278605.1.77437 WP_001278605.1.77448 WP_001278605.1.77452 WP_001278605.1.77455 WP_001278605.1.77462 WP_001278605.1.7747 WP_001278605.1.77470 WP_001278605.1.77471 WP_001278605.1.77477 WP_001278605.1.77481 WP_001278605.1.77487 WP_001278605.1.77495 WP_001278605.1.775 WP_001278605.1.7750 WP_001278605.1.77503 WP_001278605.1.77511 WP_001278605.1.77542 WP_001278605.1.77551 WP_001278605.1.7756 WP_001278605.1.77577 WP_001278605.1.77595 WP_001278605.1.77600 WP_001278605.1.77608 WP_001278605.1.77626 WP_001278605.1.77632 WP_001278605.1.77636 WP_001278605.1.77643 WP_001278605.1.77644 WP_001278605.1.77648 WP_001278605.1.77657 WP_001278605.1.77707 WP_001278605.1.77725 WP_001278605.1.77741 WP_001278605.1.7775 WP_001278605.1.77760 WP_001278605.1.77767 WP_001278605.1.77768 WP_001278605.1.7780 WP_001278605.1.7781 WP_001278605.1.77813 WP_001278605.1.77816 WP_001278605.1.77826 WP_001278605.1.77833 WP_001278605.1.77876 WP_001278605.1.77929 WP_001278605.1.77949 WP_001278605.1.7795 WP_001278605.1.77950 WP_001278605.1.77961 WP_001278605.1.77979 WP_001278605.1.7799 WP_001278605.1.77999 WP_001278605.1.78000 WP_001278605.1.78007 WP_001278605.1.78010 WP_001278605.1.7804 WP_001278605.1.78041 WP_001278605.1.78059 WP_001278605.1.7806 WP_001278605.1.78063 WP_001278605.1.7808 WP_001278605.1.78089 WP_001278605.1.78097 WP_001278605.1.78099 WP_001278605.1.78101 WP_001278605.1.78102 WP_001278605.1.78131 WP_001278605.1.78183 WP_001278605.1.78187 WP_001278605.1.78188 WP_001278605.1.78196 WP_001278605.1.78202 WP_001278605.1.78232 WP_001278605.1.78233 WP_001278605.1.78235 WP_001278605.1.78297 WP_001278605.1.78305 WP_001278605.1.78321 WP_001278605.1.78323 WP_001278605.1.78337 WP_001278605.1.78340 WP_001278605.1.78368 WP_001278605.1.78376 WP_001278605.1.78377 WP_001278605.1.78390 WP_001278605.1.784 WP_001278605.1.78413 WP_001278605.1.78445 WP_001278605.1.78453 WP_001278605.1.78462 WP_001278605.1.78463 WP_001278605.1.7847 WP_001278605.1.78477 WP_001278605.1.78481 WP_001278605.1.78491 WP_001278605.1.7851 WP_001278605.1.78512 WP_001278605.1.78523 WP_001278605.1.78527 WP_001278605.1.7855 WP_001278605.1.78553 WP_001278605.1.78572 WP_001278605.1.78575 WP_001278605.1.78581 WP_001278605.1.78583 WP_001278605.1.78586 WP_001278605.1.78593 WP_001278605.1.78610 WP_001278605.1.78611 WP_001278605.1.78612 WP_001278605.1.78615 WP_001278605.1.78622 WP_001278605.1.78645 WP_001278605.1.78677 WP_001278605.1.78683 WP_001278605.1.78689 WP_001278605.1.78696 WP_001278605.1.78698 WP_001278605.1.78706 WP_001278605.1.78714 WP_001278605.1.78718 WP_001278605.1.78746 WP_001278605.1.78750 WP_001278605.1.78757 WP_001278605.1.78773 WP_001278605.1.78775 WP_001278605.1.78791 WP_001278605.1.78814 WP_001278605.1.7883 WP_001278605.1.78843 WP_001278605.1.78845 WP_001278605.1.78854 WP_001278605.1.78888 WP_001278605.1.78891 WP_001278605.1.78893 WP_001278605.1.78895 WP_001278605.1.78908 WP_001278605.1.78919 WP_001278605.1.78953 WP_001278605.1.78956 WP_001278605.1.7896 WP_001278605.1.78966 WP_001278605.1.7898 WP_001278605.1.78996 WP_001278605.1.79001 WP_001278605.1.79002 WP_001278605.1.79004 WP_001278605.1.7901 WP_001278605.1.79065 WP_001278605.1.79067 WP_001278605.1.79075 WP_001278605.1.79086 WP_001278605.1.79088 WP_001278605.1.79090 WP_001278605.1.79092 WP_001278605.1.79100 WP_001278605.1.79126 WP_001278605.1.79137 WP_001278605.1.79159 WP_001278605.1.79172 WP_001278605.1.79226 WP_001278605.1.79233 WP_001278605.1.79243 WP_001278605.1.79246 WP_001278605.1.79248 WP_001278605.1.79249 WP_001278605.1.79276 WP_001278605.1.79306 WP_001278605.1.79308 WP_001278605.1.79312 WP_001278605.1.79342 WP_001278605.1.79346 WP_001278605.1.79348 WP_001278605.1.79356 WP_001278605.1.79365 WP_001278605.1.79368 WP_001278605.1.79369 WP_001278605.1.7937 WP_001278605.1.79389 WP_001278605.1.79391 WP_001278605.1.7940 WP_001278605.1.79409 WP_001278605.1.79414 WP_001278605.1.79416 WP_001278605.1.79443 WP_001278605.1.79464 WP_001278605.1.79478 WP_001278605.1.79505 WP_001278605.1.79519 WP_001278605.1.7952 WP_001278605.1.79525 WP_001278605.1.79526 WP_001278605.1.79528 WP_001278605.1.79540 WP_001278605.1.79558 WP_001278605.1.79563 WP_001278605.1.79576 WP_001278605.1.79591 WP_001278605.1.79606 WP_001278605.1.79619 WP_001278605.1.79640 WP_001278605.1.7967 WP_001278605.1.79685 WP_001278605.1.79707 WP_001278605.1.79713 WP_001278605.1.79715 WP_001278605.1.79749 WP_001278605.1.79759 WP_001278605.1.79764 WP_001278605.1.79800 WP_001278605.1.79816 WP_001278605.1.79824 WP_001278605.1.79840 WP_001278605.1.7985 WP_001278605.1.79866 WP_001278605.1.79869 WP_001278605.1.7987 WP_001278605.1.79871 WP_001278605.1.79877 WP_001278605.1.79905 WP_001278605.1.79922 WP_001278605.1.7993 WP_001278605.1.79930 WP_001278605.1.79931 WP_001278605.1.79932 WP_001278605.1.79933 WP_001278605.1.79936 WP_001278605.1.79944 WP_001278605.1.79952 WP_001278605.1.79955 WP_001278605.1.79965 WP_001278605.1.79973 WP_001278605.1.79984 WP_001278605.1.79995 WP_001278605.1.80 WP_001278605.1.80011 WP_001278605.1.80016 WP_001278605.1.80026 WP_001278605.1.8004 WP_001278605.1.80043 WP_001278605.1.80050 WP_001278605.1.80060 WP_001278605.1.80061 WP_001278605.1.80063 WP_001278605.1.8007 WP_001278605.1.80071 WP_001278605.1.80096 WP_001278605.1.80106 WP_001278605.1.8011 WP_001278605.1.80112 WP_001278605.1.80136 WP_001278605.1.80141 WP_001278605.1.80168 WP_001278605.1.80176 WP_001278605.1.80179 WP_001278605.1.80183 WP_001278605.1.80192 WP_001278605.1.80255 WP_001278605.1.80292 WP_001278605.1.80309 WP_001278605.1.80310 WP_001278605.1.80320 WP_001278605.1.80330 WP_001278605.1.80343 WP_001278605.1.80388 WP_001278605.1.80392 WP_001278605.1.804 WP_001278605.1.80402 WP_001278605.1.80426 WP_001278605.1.80428 WP_001278605.1.80440 WP_001278605.1.80444 WP_001278605.1.80456 WP_001278605.1.80463 WP_001278605.1.80484 WP_001278605.1.80517 WP_001278605.1.80519 WP_001278605.1.80545 WP_001278605.1.80558 WP_001278605.1.80559 WP_001278605.1.8057 WP_001278605.1.80577 WP_001278605.1.80578 WP_001278605.1.80594 WP_001278605.1.80606 WP_001278605.1.80612 WP_001278605.1.80626 WP_001278605.1.80660 WP_001278605.1.80662 WP_001278605.1.80666 WP_001278605.1.80676 WP_001278605.1.8068 WP_001278605.1.80709 WP_001278605.1.80718 WP_001278605.1.80724 WP_001278605.1.80731 WP_001278605.1.80736 WP_001278605.1.80737 WP_001278605.1.8074 WP_001278605.1.80754 WP_001278605.1.80756 WP_001278605.1.80768 WP_001278605.1.80789 WP_001278605.1.808 WP_001278605.1.80804 WP_001278605.1.80805 WP_001278605.1.80843 WP_001278605.1.80862 WP_001278605.1.80882 WP_001278605.1.80884 WP_001278605.1.80894 WP_001278605.1.8090 WP_001278605.1.8091 WP_001278605.1.80935 WP_001278605.1.80945 WP_001278605.1.80946 WP_001278605.1.80948 WP_001278605.1.80954 WP_001278605.1.80966 WP_001278605.1.80983 WP_001278605.1.80985 WP_001278605.1.810 WP_001278605.1.81026 WP_001278605.1.81032 WP_001278605.1.81034 WP_001278605.1.81054 WP_001278605.1.81056 WP_001278605.1.81070 WP_001278605.1.81071 WP_001278605.1.81098 WP_001278605.1.811 WP_001278605.1.81104 WP_001278605.1.81120 WP_001278605.1.81127 WP_001278605.1.81141 WP_001278605.1.81156 WP_001278605.1.81160 WP_001278605.1.81165 WP_001278605.1.8118 WP_001278605.1.81180 WP_001278605.1.81182 WP_001278605.1.81186 WP_001278605.1.8121 WP_001278605.1.81219 WP_001278605.1.81266 WP_001278605.1.81267 WP_001278605.1.81273 WP_001278605.1.81281 WP_001278605.1.81283 WP_001278605.1.81298 WP_001278605.1.81313 WP_001278605.1.81323 WP_001278605.1.81347 WP_001278605.1.81376 WP_001278605.1.81391 WP_001278605.1.81396 WP_001278605.1.814 WP_001278605.1.81418 WP_001278605.1.81420 WP_001278605.1.81423 WP_001278605.1.81438 WP_001278605.1.81442 WP_001278605.1.81469 WP_001278605.1.81475 WP_001278605.1.81484 WP_001278605.1.81514 WP_001278605.1.81517 WP_001278605.1.8156 WP_001278605.1.81576 WP_001278605.1.81577 WP_001278605.1.81580 WP_001278605.1.81582 WP_001278605.1.81588 WP_001278605.1.81589 WP_001278605.1.81596 WP_001278605.1.81602 WP_001278605.1.81624 WP_001278605.1.81625 WP_001278605.1.81688 WP_001278605.1.81692 WP_001278605.1.81715 WP_001278605.1.8172 WP_001278605.1.81723 WP_001278605.1.81739 WP_001278605.1.81754 WP_001278605.1.81761 WP_001278605.1.81806 WP_001278605.1.81819 WP_001278605.1.81821 WP_001278605.1.8183 WP_001278605.1.81832 WP_001278605.1.81843 WP_001278605.1.81873 WP_001278605.1.81876 WP_001278605.1.81881 WP_001278605.1.81888 WP_001278605.1.81914 WP_001278605.1.81934 WP_001278605.1.81935 WP_001278605.1.81939 WP_001278605.1.81952 WP_001278605.1.81956 WP_001278605.1.81972 WP_001278605.1.81975 WP_001278605.1.82 WP_001278605.1.82008 WP_001278605.1.82010 WP_001278605.1.82032 WP_001278605.1.82057 WP_001278605.1.82059 WP_001278605.1.82061 WP_001278605.1.82062 WP_001278605.1.82074 WP_001278605.1.82095 WP_001278605.1.82104 WP_001278605.1.82106 WP_001278605.1.82116 WP_001278605.1.82123 WP_001278605.1.82137 WP_001278605.1.82166 WP_001278605.1.82217 WP_001278605.1.82221 WP_001278605.1.82239 WP_001278605.1.82240 WP_001278605.1.82242 WP_001278605.1.82246 WP_001278605.1.82275 WP_001278605.1.82280 WP_001278605.1.82296 WP_001278605.1.82316 WP_001278605.1.82320 WP_001278605.1.82326 WP_001278605.1.82330 WP_001278605.1.8235 WP_001278605.1.82378 WP_001278605.1.82438 WP_001278605.1.82439 WP_001278605.1.82485 WP_001278605.1.82499 WP_001278605.1.82507 WP_001278605.1.82514 WP_001278605.1.82527 WP_001278605.1.82536 WP_001278605.1.82539 WP_001278605.1.8255 WP_001278605.1.82572 WP_001278605.1.82589 WP_001278605.1.82594 WP_001278605.1.82614 WP_001278605.1.82626 WP_001278605.1.82629 WP_001278605.1.82647 WP_001278605.1.8268 WP_001278605.1.82682 WP_001278605.1.82691 WP_001278605.1.82698 WP_001278605.1.82700 WP_001278605.1.82705 WP_001278605.1.82711 WP_001278605.1.82715 WP_001278605.1.82718 WP_001278605.1.82747 WP_001278605.1.82754 WP_001278605.1.8277 WP_001278605.1.82776 WP_001278605.1.82780 WP_001278605.1.82784 WP_001278605.1.82797 WP_001278605.1.82799 WP_001278605.1.82808 WP_001278605.1.82816 WP_001278605.1.82820 WP_001278605.1.82831 WP_001278605.1.82833 WP_001278605.1.82853 WP_001278605.1.82901 WP_001278605.1.82902 WP_001278605.1.82923 WP_001278605.1.8295 WP_001278605.1.82991 WP_001278605.1.83020 WP_001278605.1.83033 WP_001278605.1.83035 WP_001278605.1.83036 WP_001278605.1.83051 WP_001278605.1.83059 WP_001278605.1.8306 WP_001278605.1.8308 WP_001278605.1.83097 WP_001278605.1.83099 WP_001278605.1.831 WP_001278605.1.83118 WP_001278605.1.83125 WP_001278605.1.83127 WP_001278605.1.83140 WP_001278605.1.83144 WP_001278605.1.83151 WP_001278605.1.83160 WP_001278605.1.83177 WP_001278605.1.83205 WP_001278605.1.83214 WP_001278605.1.83218 WP_001278605.1.83224 WP_001278605.1.83238 WP_001278605.1.83253 WP_001278605.1.83256 WP_001278605.1.83286 WP_001278605.1.83313 WP_001278605.1.83321 WP_001278605.1.83330 WP_001278605.1.83340 WP_001278605.1.83347 WP_001278605.1.83375 WP_001278605.1.83393 WP_001278605.1.83415 WP_001278605.1.8345 WP_001278605.1.83466 WP_001278605.1.83506 WP_001278605.1.83537 WP_001278605.1.83544 WP_001278605.1.83564 WP_001278605.1.83644 WP_001278605.1.83660 WP_001278605.1.83668 WP_001278605.1.8368 WP_001278605.1.83684 WP_001278605.1.83706 WP_001278605.1.83712 WP_001278605.1.83735 WP_001278605.1.83762 WP_001278605.1.83781 WP_001278605.1.83820 WP_001278605.1.8384 WP_001278605.1.8386 WP_001278605.1.83879 WP_001278605.1.83911 WP_001278605.1.83936 WP_001278605.1.83941 WP_001278605.1.83947 WP_001278605.1.84004 WP_001278605.1.84014 WP_001278605.1.8405 WP_001278605.1.84060 WP_001278605.1.84074 WP_001278605.1.8408 WP_001278605.1.8411 WP_001278605.1.84140 WP_001278605.1.84164 WP_001278605.1.84172 WP_001278605.1.84185 WP_001278605.1.84197 WP_001278605.1.84210 WP_001278605.1.84215 WP_001278605.1.84219 WP_001278605.1.84221 WP_001278605.1.84264 WP_001278605.1.84298 WP_001278605.1.84312 WP_001278605.1.84313 WP_001278605.1.84316 WP_001278605.1.84319 WP_001278605.1.84326 WP_001278605.1.84331 WP_001278605.1.84339 WP_001278605.1.84348 WP_001278605.1.84402 WP_001278605.1.84405 WP_001278605.1.84410 WP_001278605.1.84436 WP_001278605.1.8444 WP_001278605.1.84462 WP_001278605.1.84464 WP_001278605.1.84467 WP_001278605.1.8447 WP_001278605.1.84473 WP_001278605.1.84476 WP_001278605.1.84482 WP_001278605.1.84484 WP_001278605.1.84486 WP_001278605.1.84511 WP_001278605.1.84518 WP_001278605.1.84531 WP_001278605.1.84534 WP_001278605.1.84584 WP_001278605.1.84635 WP_001278605.1.84639 WP_001278605.1.84656 WP_001278605.1.84657 WP_001278605.1.84668 WP_001278605.1.84675 WP_001278605.1.84697 WP_001278605.1.8470 WP_001278605.1.84731 WP_001278605.1.84738 WP_001278605.1.84740 WP_001278605.1.84768 WP_001278605.1.8477 WP_001278605.1.84784 WP_001278605.1.84797 WP_001278605.1.84841 WP_001278605.1.84850 WP_001278605.1.84875 WP_001278605.1.84877 WP_001278605.1.84878 WP_001278605.1.84881 WP_001278605.1.84893 WP_001278605.1.84894 WP_001278605.1.84916 WP_001278605.1.84929 WP_001278605.1.84941 WP_001278605.1.84948 WP_001278605.1.84972 WP_001278605.1.84977 WP_001278605.1.84986 WP_001278605.1.84989 WP_001278605.1.84990 WP_001278605.1.84994 WP_001278605.1.85002 WP_001278605.1.85008 WP_001278605.1.85011 WP_001278605.1.85025 WP_001278605.1.85048 WP_001278605.1.85052 WP_001278605.1.85077 WP_001278605.1.85090 WP_001278605.1.85098 WP_001278605.1.85105 WP_001278605.1.85106 WP_001278605.1.85112 WP_001278605.1.85125 WP_001278605.1.85129 WP_001278605.1.85138 WP_001278605.1.85141 WP_001278605.1.85155 WP_001278605.1.85156 WP_001278605.1.8517 WP_001278605.1.85175 WP_001278605.1.85188 WP_001278605.1.85216 WP_001278605.1.85241 WP_001278605.1.85247 WP_001278605.1.85252 WP_001278605.1.85253 WP_001278605.1.85255 WP_001278605.1.85260 WP_001278605.1.8530 WP_001278605.1.85305 WP_001278605.1.85310 WP_001278605.1.85315 WP_001278605.1.85320 WP_001278605.1.85323 WP_001278605.1.85329 WP_001278605.1.85335 WP_001278605.1.85336 WP_001278605.1.85342 WP_001278605.1.85361 WP_001278605.1.85369 WP_001278605.1.85384 WP_001278605.1.85385 WP_001278605.1.85416 WP_001278605.1.85500 WP_001278605.1.85504 WP_001278605.1.85525 WP_001278605.1.85546 WP_001278605.1.85554 WP_001278605.1.85556 WP_001278605.1.85558 WP_001278605.1.85563 WP_001278605.1.85578 WP_001278605.1.85593 WP_001278605.1.8560 WP_001278605.1.85601 WP_001278605.1.85621 WP_001278605.1.85623 WP_001278605.1.8564 WP_001278605.1.85657 WP_001278605.1.85685 WP_001278605.1.85722 WP_001278605.1.85752 WP_001278605.1.85762 WP_001278605.1.85767 WP_001278605.1.85772 WP_001278605.1.85773 WP_001278605.1.85781 WP_001278605.1.8579 WP_001278605.1.85793 WP_001278605.1.85800 WP_001278605.1.85806 WP_001278605.1.85857 WP_001278605.1.85895 WP_001278605.1.8592 WP_001278605.1.85939 WP_001278605.1.85944 WP_001278605.1.85948 WP_001278605.1.85969 WP_001278605.1.86 WP_001278605.1.86001 WP_001278605.1.86016 WP_001278605.1.8603 WP_001278605.1.86035 WP_001278605.1.86063 WP_001278605.1.8607 WP_001278605.1.86104 WP_001278605.1.86105 WP_001278605.1.86110 WP_001278605.1.86115 WP_001278605.1.86145 WP_001278605.1.86149 WP_001278605.1.86161 WP_001278605.1.86166 WP_001278605.1.86171 WP_001278605.1.86176 WP_001278605.1.86179 WP_001278605.1.86181 WP_001278605.1.86189 WP_001278605.1.86196 WP_001278605.1.8621 WP_001278605.1.86210 WP_001278605.1.86225 WP_001278605.1.86227 WP_001278605.1.86228 WP_001278605.1.86234 WP_001278605.1.86255 WP_001278605.1.86261 WP_001278605.1.86263 WP_001278605.1.86266 WP_001278605.1.86273 WP_001278605.1.86276 WP_001278605.1.86280 WP_001278605.1.86283 WP_001278605.1.86307 WP_001278605.1.86340 WP_001278605.1.8635 WP_001278605.1.86353 WP_001278605.1.86355 WP_001278605.1.86364 WP_001278605.1.86371 WP_001278605.1.86376 WP_001278605.1.86393 WP_001278605.1.86411 WP_001278605.1.86412 WP_001278605.1.86437 WP_001278605.1.86451 WP_001278605.1.86452 WP_001278605.1.86454 WP_001278605.1.86461 WP_001278605.1.86475 WP_001278605.1.86483 WP_001278605.1.86492 WP_001278605.1.86518 WP_001278605.1.8652 WP_001278605.1.8656 WP_001278605.1.86560 WP_001278605.1.86574 WP_001278605.1.86583 WP_001278605.1.86586 WP_001278605.1.86598 WP_001278605.1.86609 WP_001278605.1.86613 WP_001278605.1.86617 WP_001278605.1.86627 WP_001278605.1.86640 WP_001278605.1.86667 WP_001278605.1.86673 WP_001278605.1.86674 WP_001278605.1.86681 WP_001278605.1.86691 WP_001278605.1.86707 WP_001278605.1.86717 WP_001278605.1.86727 WP_001278605.1.86731 WP_001278605.1.86734 WP_001278605.1.86753 WP_001278605.1.86760 WP_001278605.1.86768 WP_001278605.1.86787 WP_001278605.1.86788 WP_001278605.1.8679 WP_001278605.1.86833 WP_001278605.1.86846 WP_001278605.1.86848 WP_001278605.1.8687 WP_001278605.1.86935 WP_001278605.1.86956 WP_001278605.1.86959 WP_001278605.1.86975 WP_001278605.1.86994 WP_001278605.1.87043 WP_001278605.1.8705 WP_001278605.1.87059 WP_001278605.1.87067 WP_001278605.1.87074 WP_001278605.1.87075 WP_001278605.1.87076 WP_001278605.1.87102 WP_001278605.1.87109 WP_001278605.1.8711 WP_001278605.1.87147 WP_001278605.1.87177 WP_001278605.1.87189 WP_001278605.1.87199 WP_001278605.1.87205 WP_001278605.1.87247 WP_001278605.1.87249 WP_001278605.1.87254 WP_001278605.1.87310 WP_001278605.1.87339 WP_001278605.1.87358 WP_001278605.1.87371 WP_001278605.1.87382 WP_001278605.1.87389 WP_001278605.1.87400 WP_001278605.1.87410 WP_001278605.1.87443 WP_001278605.1.87465 WP_001278605.1.87491 WP_001278605.1.87504 WP_001278605.1.87557 WP_001278605.1.87563 WP_001278605.1.87568 WP_001278605.1.87574 WP_001278605.1.87581 WP_001278605.1.87590 WP_001278605.1.87607 WP_001278605.1.87608 WP_001278605.1.87610 WP_001278605.1.87616 WP_001278605.1.87633 WP_001278605.1.87635 WP_001278605.1.87639 WP_001278605.1.87655 WP_001278605.1.87675 WP_001278605.1.87694 WP_001278605.1.87696 WP_001278605.1.8771 WP_001278605.1.87721 WP_001278605.1.87726 WP_001278605.1.87728 WP_001278605.1.87738 WP_001278605.1.87766 WP_001278605.1.8778 WP_001278605.1.87786 WP_001278605.1.87788 WP_001278605.1.87789 WP_001278605.1.87822 WP_001278605.1.87834 WP_001278605.1.87857 WP_001278605.1.87883 WP_001278605.1.87914 WP_001278605.1.87919 WP_001278605.1.87973 WP_001278605.1.87976 WP_001278605.1.87980 WP_001278605.1.87984 WP_001278605.1.87989 WP_001278605.1.87990 WP_001278605.1.880 WP_001278605.1.88017 WP_001278605.1.88020 WP_001278605.1.88066 WP_001278605.1.8807 WP_001278605.1.88082 WP_001278605.1.88088 WP_001278605.1.88110 WP_001278605.1.88119 WP_001278605.1.88147 WP_001278605.1.88149 WP_001278605.1.88155 WP_001278605.1.88189 WP_001278605.1.88197 WP_001278605.1.8822 WP_001278605.1.88234 WP_001278605.1.88238 WP_001278605.1.88252 WP_001278605.1.88260 WP_001278605.1.88263 WP_001278605.1.88285 WP_001278605.1.88301 WP_001278605.1.88304 WP_001278605.1.88336 WP_001278605.1.88352 WP_001278605.1.88376 WP_001278605.1.88379 WP_001278605.1.88384 WP_001278605.1.88413 WP_001278605.1.88427 WP_001278605.1.8843 WP_001278605.1.88434 WP_001278605.1.88438 WP_001278605.1.88462 WP_001278605.1.88467 WP_001278605.1.8848 WP_001278605.1.88499 WP_001278605.1.88505 WP_001278605.1.88524 WP_001278605.1.88527 WP_001278605.1.88528 WP_001278605.1.88535 WP_001278605.1.88539 WP_001278605.1.8854 WP_001278605.1.8855 WP_001278605.1.88557 WP_001278605.1.88562 WP_001278605.1.88577 WP_001278605.1.88598 WP_001278605.1.88603 WP_001278605.1.88607 WP_001278605.1.88631 WP_001278605.1.88646 WP_001278605.1.88667 WP_001278605.1.88678 WP_001278605.1.88685 WP_001278605.1.88686 WP_001278605.1.88709 WP_001278605.1.88710 WP_001278605.1.88711 WP_001278605.1.88717 WP_001278605.1.88720 WP_001278605.1.88729 WP_001278605.1.8873 WP_001278605.1.88732 WP_001278605.1.88735 WP_001278605.1.88752 WP_001278605.1.88757 WP_001278605.1.88759 WP_001278605.1.88767 WP_001278605.1.8879 WP_001278605.1.88793 WP_001278605.1.88803 WP_001278605.1.88834 WP_001278605.1.88864 WP_001278605.1.88880 WP_001278605.1.88883 WP_001278605.1.88891 WP_001278605.1.88941 WP_001278605.1.88950 WP_001278605.1.88953 WP_001278605.1.88961 WP_001278605.1.88997 WP_001278605.1.89018 WP_001278605.1.89043 WP_001278605.1.89050 WP_001278605.1.8906 WP_001278605.1.89067 WP_001278605.1.89069 WP_001278605.1.89090 WP_001278605.1.89097 WP_001278605.1.89099 WP_001278605.1.89111 WP_001278605.1.89150 WP_001278605.1.89163 WP_001278605.1.89165 WP_001278605.1.89183 WP_001278605.1.89197 WP_001278605.1.89200 WP_001278605.1.89203 WP_001278605.1.89214 WP_001278605.1.89217 WP_001278605.1.89255 WP_001278605.1.89285 WP_001278605.1.89305 WP_001278605.1.89312 WP_001278605.1.89322 WP_001278605.1.89334 WP_001278605.1.89335 WP_001278605.1.89351 WP_001278605.1.89379 WP_001278605.1.8938 WP_001278605.1.89385 WP_001278605.1.89396 WP_001278605.1.894 WP_001278605.1.89400 WP_001278605.1.89403 WP_001278605.1.89405 WP_001278605.1.89416 WP_001278605.1.89427 WP_001278605.1.89432 WP_001278605.1.8945 WP_001278605.1.89455 WP_001278605.1.89458 WP_001278605.1.89466 WP_001278605.1.89468 WP_001278605.1.89469 WP_001278605.1.89471 WP_001278605.1.89474 WP_001278605.1.89479 WP_001278605.1.89492 WP_001278605.1.89496 WP_001278605.1.89510 WP_001278605.1.89551 WP_001278605.1.89569 WP_001278605.1.89583 WP_001278605.1.89601 WP_001278605.1.89605 WP_001278605.1.89627 WP_001278605.1.89631 WP_001278605.1.89646 WP_001278605.1.89656 WP_001278605.1.89674 WP_001278605.1.89679 WP_001278605.1.89700 WP_001278605.1.89710 WP_001278605.1.89747 WP_001278605.1.89768 WP_001278605.1.89781 WP_001278605.1.89788 WP_001278605.1.89839 WP_001278605.1.89841 WP_001278605.1.89852 WP_001278605.1.89859 WP_001278605.1.89879 WP_001278605.1.89895 WP_001278605.1.89899 WP_001278605.1.89915 WP_001278605.1.89917 WP_001278605.1.89918 WP_001278605.1.89920 WP_001278605.1.89923 WP_001278605.1.89925 WP_001278605.1.89927 WP_001278605.1.89959 WP_001278605.1.89977 WP_001278605.1.89988 WP_001278605.1.89998 WP_001278605.1.90017 WP_001278605.1.90022 WP_001278605.1.90050 WP_001278605.1.90063 WP_001278605.1.90065 WP_001278605.1.90078 WP_001278605.1.9009 WP_001278605.1.9010 WP_001278605.1.90115 WP_001278605.1.90128 WP_001278605.1.90139 WP_001278605.1.90146 WP_001278605.1.90156 WP_001278605.1.90168 WP_001278605.1.90171 WP_001278605.1.90182 WP_001278605.1.902 WP_001278605.1.90205 WP_001278605.1.90219 WP_001278605.1.90249 WP_001278605.1.90256 WP_001278605.1.90257 WP_001278605.1.90266 WP_001278605.1.90270 WP_001278605.1.90314 WP_001278605.1.90332 WP_001278605.1.90342 WP_001278605.1.90346 WP_001278605.1.90349 WP_001278605.1.90357 WP_001278605.1.90358 WP_001278605.1.9036 WP_001278605.1.9037 WP_001278605.1.90389 WP_001278605.1.90405 WP_001278605.1.90435 WP_001278605.1.90436 WP_001278605.1.90441 WP_001278605.1.90449 WP_001278605.1.90467 WP_001278605.1.90511 WP_001278605.1.90520 WP_001278605.1.90525 WP_001278605.1.90536 WP_001278605.1.90547 WP_001278605.1.9059 WP_001278605.1.90591 WP_001278605.1.90602 WP_001278605.1.9061 WP_001278605.1.90626 WP_001278605.1.90690 WP_001278605.1.90703 WP_001278605.1.90706 WP_001278605.1.90758 WP_001278605.1.90775 WP_001278605.1.90799 WP_001278605.1.9081 WP_001278605.1.90822 WP_001278605.1.90828 WP_001278605.1.90834 WP_001278605.1.90837 WP_001278605.1.90839 WP_001278605.1.9084 WP_001278605.1.90842 WP_001278605.1.90844 WP_001278605.1.90848 WP_001278605.1.90856 WP_001278605.1.90864 WP_001278605.1.90865 WP_001278605.1.9087 WP_001278605.1.90873 WP_001278605.1.90890 WP_001278605.1.909 WP_001278605.1.90905 WP_001278605.1.90924 WP_001278605.1.90951 WP_001278605.1.90960 WP_001278605.1.90967 WP_001278605.1.90979 WP_001278605.1.9098 WP_001278605.1.90988 WP_001278605.1.90996 WP_001278605.1.90997 WP_001278605.1.91 WP_001278605.1.91007 WP_001278605.1.91010 WP_001278605.1.91018 WP_001278605.1.9104 WP_001278605.1.91072 WP_001278605.1.91088 WP_001278605.1.91094 WP_001278605.1.91113 WP_001278605.1.91117 WP_001278605.1.91121 WP_001278605.1.91138 WP_001278605.1.91143 WP_001278605.1.91153 WP_001278605.1.91170 WP_001278605.1.9118 WP_001278605.1.91182 WP_001278605.1.9119 WP_001278605.1.91213 WP_001278605.1.91220 WP_001278605.1.91266 WP_001278605.1.91268 WP_001278605.1.91277 WP_001278605.1.91288 WP_001278605.1.91290 WP_001278605.1.91340 WP_001278605.1.91341 WP_001278605.1.91354 WP_001278605.1.91356 WP_001278605.1.91361 WP_001278605.1.91384 WP_001278605.1.91397 WP_001278605.1.91425 WP_001278605.1.91445 WP_001278605.1.91462 WP_001278605.1.91482 WP_001278605.1.91485 WP_001278605.1.915 WP_001278605.1.91511 WP_001278605.1.91515 WP_001278605.1.91516 WP_001278605.1.91526 WP_001278605.1.91543 WP_001278605.1.91548 WP_001278605.1.91549 WP_001278605.1.91565 WP_001278605.1.91566 WP_001278605.1.9157 WP_001278605.1.91594 WP_001278605.1.91596 WP_001278605.1.9160 WP_001278605.1.91626 WP_001278605.1.91630 WP_001278605.1.91640 WP_001278605.1.91643 WP_001278605.1.91644 WP_001278605.1.91651 WP_001278605.1.91666 WP_001278605.1.91672 WP_001278605.1.9168 WP_001278605.1.91685 WP_001278605.1.9169 WP_001278605.1.91701 WP_001278605.1.9171 WP_001278605.1.91739 WP_001278605.1.91756 WP_001278605.1.91777 WP_001278605.1.91779 WP_001278605.1.91782 WP_001278605.1.91787 WP_001278605.1.91793 WP_001278605.1.91801 WP_001278605.1.91814 WP_001278605.1.91843 WP_001278605.1.9185 WP_001278605.1.91850 WP_001278605.1.91871 WP_001278605.1.91879 WP_001278605.1.91887 WP_001278605.1.91893 WP_001278605.1.91951 WP_001278605.1.91954 WP_001278605.1.91959 WP_001278605.1.91965 WP_001278605.1.91971 WP_001278605.1.9199 WP_001278605.1.91994 WP_001278605.1.92005 WP_001278605.1.92014 WP_001278605.1.92019 WP_001278605.1.92025 WP_001278605.1.92029 WP_001278605.1.92031 WP_001278605.1.92048 WP_001278605.1.92053 WP_001278605.1.92058 WP_001278605.1.9209 WP_001278605.1.92096 WP_001278605.1.921 WP_001278605.1.92102 WP_001278605.1.92114 WP_001278605.1.92123 WP_001278605.1.9215 WP_001278605.1.92161 WP_001278605.1.92163 WP_001278605.1.92180 WP_001278605.1.92195 WP_001278605.1.92201 WP_001278605.1.92215 WP_001278605.1.92224 WP_001278605.1.92276 WP_001278605.1.92295 WP_001278605.1.92304 WP_001278605.1.92305 WP_001278605.1.92311 WP_001278605.1.92323 WP_001278605.1.92361 WP_001278605.1.92384 WP_001278605.1.924 WP_001278605.1.92403 WP_001278605.1.92434 WP_001278605.1.92462 WP_001278605.1.92473 WP_001278605.1.92495 WP_001278605.1.92496 WP_001278605.1.92506 WP_001278605.1.92532 WP_001278605.1.92535 WP_001278605.1.9255 WP_001278605.1.92568 WP_001278605.1.92571 WP_001278605.1.92577 WP_001278605.1.92614 WP_001278605.1.92615 WP_001278605.1.92634 WP_001278605.1.92638 WP_001278605.1.9264 WP_001278605.1.92648 WP_001278605.1.9266 WP_001278605.1.92668 WP_001278605.1.92693 WP_001278605.1.92708 WP_001278605.1.92719 WP_001278605.1.92742 WP_001278605.1.92750 WP_001278605.1.92767 WP_001278605.1.92780 WP_001278605.1.92781 WP_001278605.1.92792 WP_001278605.1.92793 WP_001278605.1.92796 WP_001278605.1.92819 WP_001278605.1.92845 WP_001278605.1.92865 WP_001278605.1.92882 WP_001278605.1.92886 WP_001278605.1.92932 WP_001278605.1.92943 WP_001278605.1.92953 WP_001278605.1.92989 WP_001278605.1.92991 WP_001278605.1.93005 WP_001278605.1.93016 WP_001278605.1.93017 WP_001278605.1.93019 WP_001278605.1.93027 WP_001278605.1.93033 WP_001278605.1.93048 WP_001278605.1.93052 WP_001278605.1.93054 WP_001278605.1.93069 WP_001278605.1.93072 WP_001278605.1.93085 WP_001278605.1.93100 WP_001278605.1.93112 WP_001278605.1.93133 WP_001278605.1.93138 WP_001278605.1.93139 WP_001278605.1.93150 WP_001278605.1.93167 WP_001278605.1.93175 WP_001278605.1.93185 WP_001278605.1.93233 WP_001278605.1.93252 WP_001278605.1.93267 WP_001278605.1.9327 WP_001278605.1.93276 WP_001278605.1.93291 WP_001278605.1.93309 WP_001278605.1.9331 WP_001278605.1.93312 WP_001278605.1.93326 WP_001278605.1.93338 WP_001278605.1.93379 WP_001278605.1.93388 WP_001278605.1.934 WP_001278605.1.93427 WP_001278605.1.93428 WP_001278605.1.93431 WP_001278605.1.93453 WP_001278605.1.93461 WP_001278605.1.93463 WP_001278605.1.93464 WP_001278605.1.93468 WP_001278605.1.93509 WP_001278605.1.93531 WP_001278605.1.93533 WP_001278605.1.93552 WP_001278605.1.9356 WP_001278605.1.93569 WP_001278605.1.93601 WP_001278605.1.93605 WP_001278605.1.93629 WP_001278605.1.93630 WP_001278605.1.93634 WP_001278605.1.93637 WP_001278605.1.93639 WP_001278605.1.93652 WP_001278605.1.93665 WP_001278605.1.93670 WP_001278605.1.93673 WP_001278605.1.93679 WP_001278605.1.93694 WP_001278605.1.93695 WP_001278605.1.93716 WP_001278605.1.93733 WP_001278605.1.93737 WP_001278605.1.93742 WP_001278605.1.93743 WP_001278605.1.93755 WP_001278605.1.93765 WP_001278605.1.93768 WP_001278605.1.938 WP_001278605.1.93800 WP_001278605.1.93821 WP_001278605.1.93870 WP_001278605.1.93873 WP_001278605.1.93877 WP_001278605.1.939 WP_001278605.1.93900 WP_001278605.1.93911 WP_001278605.1.93918 WP_001278605.1.93921 WP_001278605.1.93922 WP_001278605.1.93939 WP_001278605.1.93951 WP_001278605.1.93952 WP_001278605.1.93971 WP_001278605.1.94008 WP_001278605.1.94011 WP_001278605.1.94025 WP_001278605.1.94028 WP_001278605.1.94035 WP_001278605.1.94040 WP_001278605.1.94057 WP_001278605.1.94069 WP_001278605.1.94156 WP_001278605.1.9416 WP_001278605.1.94176 WP_001278605.1.94187 WP_001278605.1.94190 WP_001278605.1.9420 WP_001278605.1.94213 WP_001278605.1.94232 WP_001278605.1.9426 WP_001278605.1.94282 WP_001278605.1.94298 WP_001278605.1.94302 WP_001278605.1.94317 WP_001278605.1.94343 WP_001278605.1.94353 WP_001278605.1.94367 WP_001278605.1.94388 WP_001278605.1.94404 WP_001278605.1.94417 WP_001278605.1.94429 WP_001278605.1.94430 WP_001278605.1.94436 WP_001278605.1.94438 WP_001278605.1.94445 WP_001278605.1.94446 WP_001278605.1.94468 WP_001278605.1.94475 WP_001278605.1.94497 WP_001278605.1.94507 WP_001278605.1.94516 WP_001278605.1.94523 WP_001278605.1.94542 WP_001278605.1.94544 WP_001278605.1.94548 WP_001278605.1.9457 WP_001278605.1.94578 WP_001278605.1.94580 WP_001278605.1.94589 WP_001278605.1.94619 WP_001278605.1.94626 WP_001278605.1.94646 WP_001278605.1.94653 WP_001278605.1.94676 WP_001278605.1.94686 WP_001278605.1.94690 WP_001278605.1.94692 WP_001278605.1.94695 WP_001278605.1.94704 WP_001278605.1.94727 WP_001278605.1.94738 WP_001278605.1.94739 WP_001278605.1.9474 WP_001278605.1.94753 WP_001278605.1.94754 WP_001278605.1.94764 WP_001278605.1.94787 WP_001278605.1.94790 WP_001278605.1.948 WP_001278605.1.94801 WP_001278605.1.94806 WP_001278605.1.94808 WP_001278605.1.94822 WP_001278605.1.94823 WP_001278605.1.94836 WP_001278605.1.94841 WP_001278605.1.94847 WP_001278605.1.94869 WP_001278605.1.94877 WP_001278605.1.94880 WP_001278605.1.94889 WP_001278605.1.9489 WP_001278605.1.94892 WP_001278605.1.94898 WP_001278605.1.949 WP_001278605.1.94903 WP_001278605.1.9491 WP_001278605.1.94927 WP_001278605.1.94934 WP_001278605.1.94938 WP_001278605.1.94949 WP_001278605.1.94955 WP_001278605.1.94963 WP_001278605.1.94991 WP_001278605.1.94993 WP_001278605.1.94997 WP_001278605.1.95005 WP_001278605.1.95011 WP_001278605.1.95022 WP_001278605.1.95028 WP_001278605.1.95035 WP_001278605.1.95036 WP_001278605.1.95037 WP_001278605.1.95080 WP_001278605.1.95084 WP_001278605.1.95105 WP_001278605.1.95129 WP_001278605.1.9513 WP_001278605.1.95161 WP_001278605.1.95198 WP_001278605.1.95233 WP_001278605.1.95243 WP_001278605.1.95244 WP_001278605.1.95254 WP_001278605.1.95275 WP_001278605.1.95310 WP_001278605.1.95329 WP_001278605.1.95332 WP_001278605.1.95364 WP_001278605.1.95366 WP_001278605.1.95368 WP_001278605.1.95378 WP_001278605.1.95381 WP_001278605.1.95390 WP_001278605.1.95395 WP_001278605.1.95398 WP_001278605.1.95400 WP_001278605.1.95403 WP_001278605.1.95424 WP_001278605.1.95428 WP_001278605.1.95431 WP_001278605.1.95438 WP_001278605.1.95449 WP_001278605.1.95490 WP_001278605.1.95521 WP_001278605.1.95563 WP_001278605.1.9559 WP_001278605.1.95595 WP_001278605.1.95596 WP_001278605.1.95604 WP_001278605.1.95611 WP_001278605.1.95628 WP_001278605.1.95634 WP_001278605.1.95655 WP_001278605.1.9566 WP_001278605.1.95666 WP_001278605.1.95712 WP_001278605.1.95756 WP_001278605.1.95759 WP_001278605.1.95771 WP_001278605.1.95783 WP_001278605.1.95784 WP_001278605.1.95800 WP_001278605.1.95821 WP_001278605.1.95824 WP_001278605.1.95827 WP_001278605.1.95834 WP_001278605.1.95835 WP_001278605.1.95846 WP_001278605.1.95849 WP_001278605.1.95858 WP_001278605.1.95861 WP_001278605.1.95865 WP_001278605.1.95869 WP_001278605.1.95916 WP_001278605.1.95919 WP_001278605.1.95929 WP_001278605.1.95931 WP_001278605.1.95932 WP_001278605.1.95951 WP_001278605.1.96015 WP_001278605.1.96032 WP_001278605.1.96053 WP_001278605.1.96059 WP_001278605.1.96066 WP_001278605.1.96086 WP_001278605.1.96097 WP_001278605.1.96110 WP_001278605.1.96114 WP_001278605.1.96128 WP_001278605.1.96143 WP_001278605.1.96145 WP_001278605.1.9616 WP_001278605.1.96177 WP_001278605.1.96215 WP_001278605.1.96222 WP_001278605.1.96223 WP_001278605.1.96247 WP_001278605.1.96253 WP_001278605.1.96263 WP_001278605.1.96278 WP_001278605.1.96281 WP_001278605.1.96290 WP_001278605.1.96293 WP_001278605.1.96299 WP_001278605.1.96303 WP_001278605.1.96339 WP_001278605.1.96341 WP_001278605.1.96378 WP_001278605.1.96392 WP_001278605.1.96394 WP_001278605.1.9641 WP_001278605.1.96417 WP_001278605.1.96420 WP_001278605.1.96425 WP_001278605.1.96450 WP_001278605.1.96457 WP_001278605.1.96478 WP_001278605.1.96479 WP_001278605.1.96480 WP_001278605.1.96484 WP_001278605.1.9649 WP_001278605.1.96494 WP_001278605.1.965 WP_001278605.1.96519 WP_001278605.1.96558 WP_001278605.1.96562 WP_001278605.1.9657 WP_001278605.1.96585 WP_001278605.1.96608 WP_001278605.1.96609 WP_001278605.1.9661 WP_001278605.1.96617 WP_001278605.1.96633 WP_001278605.1.96650 WP_001278605.1.96659 WP_001278605.1.96676 WP_001278605.1.9668 WP_001278605.1.96680 WP_001278605.1.96683 WP_001278605.1.96695 WP_001278605.1.96701 WP_001278605.1.9671 WP_001278605.1.96725 WP_001278605.1.96743 WP_001278605.1.96753 WP_001278605.1.96759 WP_001278605.1.96762 WP_001278605.1.96769 WP_001278605.1.96779 WP_001278605.1.96796 WP_001278605.1.96797 WP_001278605.1.96817 WP_001278605.1.9682 WP_001278605.1.96820 WP_001278605.1.96850 WP_001278605.1.96864 WP_001278605.1.96894 WP_001278605.1.9690 WP_001278605.1.96907 WP_001278605.1.9691 WP_001278605.1.96924 WP_001278605.1.96932 WP_001278605.1.96936 WP_001278605.1.96944 WP_001278605.1.96971 WP_001278605.1.96984 WP_001278605.1.96989 WP_001278605.1.97011 WP_001278605.1.97027 WP_001278605.1.97059 WP_001278605.1.9708 WP_001278605.1.97119 WP_001278605.1.97123 WP_001278605.1.97147 WP_001278605.1.97160 WP_001278605.1.97170 WP_001278605.1.97193 WP_001278605.1.97195 WP_001278605.1.97200 WP_001278605.1.97226 WP_001278605.1.9723 WP_001278605.1.97231 WP_001278605.1.97238 WP_001278605.1.97247 WP_001278605.1.97248 WP_001278605.1.97269 WP_001278605.1.97279 WP_001278605.1.97282 WP_001278605.1.9729 WP_001278605.1.97292 WP_001278605.1.97344 WP_001278605.1.97351 WP_001278605.1.97356 WP_001278605.1.97360 WP_001278605.1.97361 WP_001278605.1.97379 WP_001278605.1.9740 WP_001278605.1.97402 WP_001278605.1.97418 WP_001278605.1.97421 WP_001278605.1.97434 WP_001278605.1.97437 WP_001278605.1.97439 WP_001278605.1.97459 WP_001278605.1.97464 WP_001278605.1.9747 WP_001278605.1.97502 WP_001278605.1.97513 WP_001278605.1.97525 WP_001278605.1.97527 WP_001278605.1.97538 WP_001278605.1.97544 WP_001278605.1.97549 WP_001278605.1.97560 WP_001278605.1.97571 WP_001278605.1.97619 WP_001278605.1.97632 WP_001278605.1.97654 WP_001278605.1.97667 WP_001278605.1.97675 WP_001278605.1.97677 WP_001278605.1.97685 WP_001278605.1.9770 WP_001278605.1.97705 WP_001278605.1.97711 WP_001278605.1.97770 WP_001278605.1.97775 WP_001278605.1.97778 WP_001278605.1.97789 WP_001278605.1.97798 WP_001278605.1.978 WP_001278605.1.97802 WP_001278605.1.97815 WP_001278605.1.97822 WP_001278605.1.97823 WP_001278605.1.97825 WP_001278605.1.97871 WP_001278605.1.97890 WP_001278605.1.97895 WP_001278605.1.97919 WP_001278605.1.97930 WP_001278605.1.97932 WP_001278605.1.97937 WP_001278605.1.97962 WP_001278605.1.97982 WP_001278605.1.97996 WP_001278605.1.98000 WP_001278605.1.98005 WP_001278605.1.98012 WP_001278605.1.98026 WP_001278605.1.9803 WP_001278605.1.98046 WP_001278605.1.98082 WP_001278605.1.98083 WP_001278605.1.981 WP_001278605.1.98102 WP_001278605.1.98115 WP_001278605.1.98139 WP_001278605.1.98155 WP_001278605.1.9816 WP_001278605.1.98167 WP_001278605.1.9817 WP_001278605.1.98176 WP_001278605.1.98187 WP_001278605.1.98202 WP_001278605.1.98205 WP_001278605.1.98208 WP_001278605.1.98232 WP_001278605.1.98239 WP_001278605.1.98241 WP_001278605.1.98244 WP_001278605.1.98251 WP_001278605.1.98279 WP_001278605.1.98284 WP_001278605.1.98292 WP_001278605.1.98294 WP_001278605.1.98301 WP_001278605.1.98312 WP_001278605.1.98323 WP_001278605.1.98355 WP_001278605.1.98357 WP_001278605.1.98384 WP_001278605.1.98400 WP_001278605.1.98404 WP_001278605.1.98424 WP_001278605.1.98429 WP_001278605.1.9844 WP_001278605.1.98442 WP_001278605.1.98451 WP_001278605.1.98466 WP_001278605.1.98477 WP_001278605.1.98480 WP_001278605.1.98484 WP_001278605.1.98498 WP_001278605.1.98543 WP_001278605.1.98549 WP_001278605.1.98569 WP_001278605.1.98578 WP_001278605.1.9858 WP_001278605.1.98603 WP_001278605.1.98614 WP_001278605.1.98626 WP_001278605.1.98633 WP_001278605.1.9864 WP_001278605.1.98641 WP_001278605.1.98654 WP_001278605.1.98665 WP_001278605.1.98668 WP_001278605.1.98702 WP_001278605.1.98727 WP_001278605.1.98757 WP_001278605.1.98775 WP_001278605.1.98776 WP_001278605.1.98784 WP_001278605.1.98795 WP_001278605.1.9883 WP_001278605.1.98875 WP_001278605.1.98886 WP_001278605.1.98908 WP_001278605.1.98920 WP_001278605.1.98976 WP_001278605.1.98988 WP_001278605.1.99006 WP_001278605.1.99029 WP_001278605.1.99046 WP_001278605.1.99053 WP_001278605.1.99060 WP_001278605.1.9907 WP_001278605.1.99101 WP_001278605.1.99110 WP_001278605.1.99119 WP_001278605.1.99168 WP_001278605.1.99182 WP_001278605.1.99234 WP_001278605.1.99246 WP_001278605.1.99265 WP_001278605.1.99289 WP_001278605.1.99292 WP_001278605.1.99295 WP_001278605.1.9930 WP_001278605.1.99302 WP_001278605.1.99304 WP_001278605.1.99306 WP_001278605.1.99307 WP_001278605.1.99310 WP_001278605.1.99319 WP_001278605.1.99334 WP_001278605.1.99345 WP_001278605.1.99349 WP_001278605.1.9935 WP_001278605.1.99361 WP_001278605.1.99366 WP_001278605.1.99392 WP_001278605.1.9940 WP_001278605.1.99400 WP_001278605.1.99401 WP_001278605.1.99427 WP_001278605.1.99446 WP_001278605.1.99453 WP_001278605.1.99458 WP_001278605.1.99471 WP_001278605.1.99472 WP_001278605.1.99475 WP_001278605.1.99486 WP_001278605.1.99487 WP_001278605.1.99498 WP_001278605.1.9950 WP_001278605.1.99501 WP_001278605.1.99534 WP_001278605.1.99549 WP_001278605.1.99562 WP_001278605.1.99571 WP_001278605.1.99592 WP_001278605.1.99602 WP_001278605.1.99603 WP_001278605.1.99619 WP_001278605.1.99632 WP_001278605.1.99641 WP_001278605.1.99666 WP_001278605.1.99692 WP_001278605.1.99694 WP_001278605.1.99698 WP_001278605.1.99734 WP_001278605.1.99771 WP_001278605.1.99774 WP_001278605.1.99782 WP_001278605.1.99791 WP_001278605.1.99804 WP_001278605.1.99827 WP_001278605.1.99869 WP_001278605.1.99874 WP_001278605.1.99891 WP_001278605.1.99892 WP_001278605.1.99912 WP_001278605.1.99929 WP_001278605.1.99986 YP_002406651.1.10275 YP_002411510.1.14968 YP_006118959.1.29421 YP_006780333.1.12065 YP_402282.1.10455 gi|218553200|ref|YP_002386113.1| gi|387505718|ref|YP_006157974.1| gi|443616695|ref|YP_007380551.1| gi|388476761|ref|YP_488949.1| gi|238899935|ref|YP_002925731.1| gi|291281607|ref|YP_003498425.1| gi|260842884|ref|YP_003220662.1| gi|218703991|ref|YP_002411510.1| gi|387881235|ref|YP_006311537.1| gi|386708440|ref|YP_006172161.1| 4hg0_A gi|544575064|ref|YP_008570588.1| gi|170020985|ref|YP_001725939.1| gi|218549765|ref|YP_002383556.1| gi|251784159|ref|YP_002998463.1| gi|16128641|ref|NP_415191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]