SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15831286|ref|NP_310059.1| from Escherichia coli O157:H7 str. Sakai

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15831286|ref|NP_310059.1|
Domain Number 1 Region: 7-98
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000073
Family N-acetyl transferase, NAT 0.0000379
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15831286|ref|NP_310059.1|
Sequence length 98
Comment ribosomal-protein-serine N-acetyltransferase [Escherichia coli O157:H7 str. Sakai]
Sequence
MTETIKVSESLELHAVAENHVTPLYQLICKNKTWLQQSLNWPQFVQIEEDTRKTVQGNVM
LHQRGYAKMFMIFKEDELIGVISFNRIEPLNKTAEIGY
Download sequence
Identical sequences A0A0F6C3Y0 A0A0F6F615 A0A1Z3V4F6 C3SDM1 Q8X9V3
gi|15831286|ref|NP_310059.1| NP_310059.1.58667 WP_000140874.1.100073 WP_000140874.1.100299 WP_000140874.1.100302 WP_000140874.1.100508 WP_000140874.1.100925 WP_000140874.1.101105 WP_000140874.1.101206 WP_000140874.1.101628 WP_000140874.1.10206 WP_000140874.1.102094 WP_000140874.1.10273 WP_000140874.1.10476 WP_000140874.1.10761 WP_000140874.1.1111 WP_000140874.1.11301 WP_000140874.1.11420 WP_000140874.1.11671 WP_000140874.1.12305 WP_000140874.1.12552 WP_000140874.1.13060 WP_000140874.1.13217 WP_000140874.1.13332 WP_000140874.1.13430 WP_000140874.1.13442 WP_000140874.1.13881 WP_000140874.1.13939 WP_000140874.1.14621 WP_000140874.1.15527 WP_000140874.1.1559 WP_000140874.1.15626 WP_000140874.1.15782 WP_000140874.1.16075 WP_000140874.1.16133 WP_000140874.1.16272 WP_000140874.1.16463 WP_000140874.1.16481 WP_000140874.1.16845 WP_000140874.1.17187 WP_000140874.1.17515 WP_000140874.1.18136 WP_000140874.1.18326 WP_000140874.1.1834 WP_000140874.1.1881 WP_000140874.1.18837 WP_000140874.1.18995 WP_000140874.1.19039 WP_000140874.1.191 WP_000140874.1.19140 WP_000140874.1.19840 WP_000140874.1.19847 WP_000140874.1.2005 WP_000140874.1.20449 WP_000140874.1.20546 WP_000140874.1.20594 WP_000140874.1.20745 WP_000140874.1.21668 WP_000140874.1.22251 WP_000140874.1.22381 WP_000140874.1.22743 WP_000140874.1.22925 WP_000140874.1.23115 WP_000140874.1.23241 WP_000140874.1.23323 WP_000140874.1.23467 WP_000140874.1.23790 WP_000140874.1.23838 WP_000140874.1.23895 WP_000140874.1.23899 WP_000140874.1.23973 WP_000140874.1.23984 WP_000140874.1.24070 WP_000140874.1.24283 WP_000140874.1.24341 WP_000140874.1.25076 WP_000140874.1.25082 WP_000140874.1.25201 WP_000140874.1.25305 WP_000140874.1.25794 WP_000140874.1.25819 WP_000140874.1.26134 WP_000140874.1.26474 WP_000140874.1.26878 WP_000140874.1.27338 WP_000140874.1.28143 WP_000140874.1.28551 WP_000140874.1.28734 WP_000140874.1.28879 WP_000140874.1.291 WP_000140874.1.29126 WP_000140874.1.29564 WP_000140874.1.29597 WP_000140874.1.29618 WP_000140874.1.29818 WP_000140874.1.29976 WP_000140874.1.30 WP_000140874.1.30019 WP_000140874.1.30064 WP_000140874.1.30164 WP_000140874.1.30476 WP_000140874.1.30637 WP_000140874.1.30918 WP_000140874.1.30993 WP_000140874.1.312 WP_000140874.1.3140 WP_000140874.1.31401 WP_000140874.1.31575 WP_000140874.1.31715 WP_000140874.1.32063 WP_000140874.1.32243 WP_000140874.1.32536 WP_000140874.1.32590 WP_000140874.1.33094 WP_000140874.1.33125 WP_000140874.1.33178 WP_000140874.1.33981 WP_000140874.1.34269 WP_000140874.1.34686 WP_000140874.1.35393 WP_000140874.1.3550 WP_000140874.1.36212 WP_000140874.1.36626 WP_000140874.1.36767 WP_000140874.1.37102 WP_000140874.1.37372 WP_000140874.1.3762 WP_000140874.1.37769 WP_000140874.1.38050 WP_000140874.1.38063 WP_000140874.1.38306 WP_000140874.1.389 WP_000140874.1.39180 WP_000140874.1.39268 WP_000140874.1.39415 WP_000140874.1.39564 WP_000140874.1.39601 WP_000140874.1.39646 WP_000140874.1.40113 WP_000140874.1.40234 WP_000140874.1.40549 WP_000140874.1.40629 WP_000140874.1.40742 WP_000140874.1.41060 WP_000140874.1.41294 WP_000140874.1.41478 WP_000140874.1.41536 WP_000140874.1.41734 WP_000140874.1.41849 WP_000140874.1.4213 WP_000140874.1.42447 WP_000140874.1.42513 WP_000140874.1.4261 WP_000140874.1.42863 WP_000140874.1.43079 WP_000140874.1.43121 WP_000140874.1.43140 WP_000140874.1.43196 WP_000140874.1.43384 WP_000140874.1.43536 WP_000140874.1.43754 WP_000140874.1.43798 WP_000140874.1.43816 WP_000140874.1.43837 WP_000140874.1.43911 WP_000140874.1.43939 WP_000140874.1.44125 WP_000140874.1.44488 WP_000140874.1.44733 WP_000140874.1.44906 WP_000140874.1.44954 WP_000140874.1.45076 WP_000140874.1.45153 WP_000140874.1.45195 WP_000140874.1.45293 WP_000140874.1.45575 WP_000140874.1.45707 WP_000140874.1.45841 WP_000140874.1.45901 WP_000140874.1.45941 WP_000140874.1.46039 WP_000140874.1.4619 WP_000140874.1.46414 WP_000140874.1.46451 WP_000140874.1.46503 WP_000140874.1.46626 WP_000140874.1.4708 WP_000140874.1.47140 WP_000140874.1.47411 WP_000140874.1.47784 WP_000140874.1.47994 WP_000140874.1.4812 WP_000140874.1.48176 WP_000140874.1.48697 WP_000140874.1.48712 WP_000140874.1.48792 WP_000140874.1.48806 WP_000140874.1.4931 WP_000140874.1.49332 WP_000140874.1.49401 WP_000140874.1.5003 WP_000140874.1.50110 WP_000140874.1.50380 WP_000140874.1.50549 WP_000140874.1.50762 WP_000140874.1.51171 WP_000140874.1.51505 WP_000140874.1.51643 WP_000140874.1.51693 WP_000140874.1.51834 WP_000140874.1.52039 WP_000140874.1.5217 WP_000140874.1.52496 WP_000140874.1.52543 WP_000140874.1.52933 WP_000140874.1.53084 WP_000140874.1.53211 WP_000140874.1.54024 WP_000140874.1.5441 WP_000140874.1.5467 WP_000140874.1.55218 WP_000140874.1.55820 WP_000140874.1.55838 WP_000140874.1.55892 WP_000140874.1.56392 WP_000140874.1.56481 WP_000140874.1.56491 WP_000140874.1.56554 WP_000140874.1.57032 WP_000140874.1.57180 WP_000140874.1.57280 WP_000140874.1.57610 WP_000140874.1.5764 WP_000140874.1.57646 WP_000140874.1.57836 WP_000140874.1.58048 WP_000140874.1.58057 WP_000140874.1.58169 WP_000140874.1.58238 WP_000140874.1.584 WP_000140874.1.59374 WP_000140874.1.59733 WP_000140874.1.59838 WP_000140874.1.59905 WP_000140874.1.60043 WP_000140874.1.60117 WP_000140874.1.60304 WP_000140874.1.60374 WP_000140874.1.60461 WP_000140874.1.60647 WP_000140874.1.60744 WP_000140874.1.60761 WP_000140874.1.61039 WP_000140874.1.61099 WP_000140874.1.61108 WP_000140874.1.61623 WP_000140874.1.618 WP_000140874.1.61874 WP_000140874.1.62480 WP_000140874.1.62675 WP_000140874.1.6331 WP_000140874.1.63872 WP_000140874.1.64086 WP_000140874.1.64371 WP_000140874.1.6445 WP_000140874.1.64946 WP_000140874.1.65035 WP_000140874.1.65372 WP_000140874.1.65546 WP_000140874.1.65875 WP_000140874.1.65963 WP_000140874.1.65978 WP_000140874.1.66033 WP_000140874.1.66531 WP_000140874.1.66566 WP_000140874.1.66873 WP_000140874.1.66922 WP_000140874.1.67136 WP_000140874.1.67214 WP_000140874.1.67533 WP_000140874.1.67676 WP_000140874.1.6769 WP_000140874.1.67726 WP_000140874.1.67775 WP_000140874.1.67780 WP_000140874.1.68096 WP_000140874.1.68493 WP_000140874.1.68523 WP_000140874.1.6887 WP_000140874.1.69350 WP_000140874.1.69351 WP_000140874.1.69896 WP_000140874.1.70123 WP_000140874.1.70125 WP_000140874.1.70539 WP_000140874.1.70576 WP_000140874.1.70723 WP_000140874.1.71003 WP_000140874.1.71205 WP_000140874.1.71423 WP_000140874.1.72016 WP_000140874.1.72180 WP_000140874.1.72322 WP_000140874.1.72641 WP_000140874.1.7291 WP_000140874.1.72913 WP_000140874.1.73343 WP_000140874.1.73785 WP_000140874.1.73801 WP_000140874.1.7392 WP_000140874.1.73968 WP_000140874.1.7429 WP_000140874.1.7446 WP_000140874.1.74521 WP_000140874.1.74536 WP_000140874.1.75248 WP_000140874.1.7539 WP_000140874.1.75507 WP_000140874.1.75536 WP_000140874.1.7608 WP_000140874.1.76189 WP_000140874.1.76407 WP_000140874.1.76827 WP_000140874.1.77099 WP_000140874.1.77275 WP_000140874.1.77644 WP_000140874.1.77760 WP_000140874.1.77961 WP_000140874.1.78063 WP_000140874.1.784 WP_000140874.1.7855 WP_000140874.1.78593 WP_000140874.1.78611 WP_000140874.1.79172 WP_000140874.1.79563 WP_000140874.1.79715 WP_000140874.1.79965 WP_000140874.1.80309 WP_000140874.1.80330 WP_000140874.1.80606 WP_000140874.1.81070 WP_000140874.1.81273 WP_000140874.1.81420 WP_000140874.1.81442 WP_000140874.1.81821 WP_000140874.1.81873 WP_000140874.1.81975 WP_000140874.1.82594 WP_000140874.1.82629 WP_000140874.1.82820 WP_000140874.1.83099 WP_000140874.1.84219 WP_000140874.1.84482 WP_000140874.1.84635 WP_000140874.1.84657 WP_000140874.1.8477 WP_000140874.1.85253 WP_000140874.1.85558 WP_000140874.1.85722 WP_000140874.1.86171 WP_000140874.1.86225 WP_000140874.1.86255 WP_000140874.1.86340 WP_000140874.1.87247 WP_000140874.1.87254 WP_000140874.1.88197 WP_000140874.1.8843 WP_000140874.1.88528 WP_000140874.1.88891 WP_000140874.1.89322 WP_000140874.1.89405 WP_000140874.1.89569 WP_000140874.1.89988 WP_000140874.1.90219 WP_000140874.1.90257 WP_000140874.1.90837 WP_000140874.1.90848 WP_000140874.1.90967 WP_000140874.1.9098 WP_000140874.1.91072 WP_000140874.1.91088 WP_000140874.1.91288 WP_000140874.1.91548 WP_000140874.1.91651 WP_000140874.1.9168 WP_000140874.1.91871 WP_000140874.1.92819 WP_000140874.1.93027 WP_000140874.1.93069 WP_000140874.1.93427 WP_000140874.1.93428 WP_000140874.1.94213 WP_000140874.1.94302 WP_000140874.1.94343 WP_000140874.1.94589 WP_000140874.1.94676 WP_000140874.1.94790 WP_000140874.1.95011 WP_000140874.1.95028 WP_000140874.1.96725 WP_000140874.1.96796 WP_000140874.1.97193 WP_000140874.1.97402 WP_000140874.1.97513 WP_000140874.1.9770 WP_000140874.1.97789 WP_000140874.1.98083 WP_000140874.1.98176 WP_000140874.1.98205 WP_000140874.1.98384 WP_000140874.1.98920 WP_000140874.1.99487 WP_000140874.1.99501 WP_000140874.1.99692 gi|387882444|ref|YP_006312746.1| 155864.Z2291 386585.ECs2032 gi|15801715|ref|NP_287733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]