SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15831306|ref|NP_310079.1| from Escherichia coli O157:H7 str. Sakai

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15831306|ref|NP_310079.1|
Domain Number 1 Region: 3-165
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.4e-35
Family N-acetyl transferase, NAT 0.00000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15831306|ref|NP_310079.1|
Sequence length 172
Comment resistance protein [Escherichia coli O157:H7 str. Sakai]
Sequence
MSIRFARKADCAAIAEIYNHAVLYTAAIWNDQTVDADNRIAWFEARTIAGYPVLVSEEDG
VVTGYASFGDWRSFDGFRHTVEHSVYVHPDHQGKGLGRKLLSRLIDEARDCGKHVMVAGI
ESQNQASLHLHQSLGFVVTAQMPQVGTKFGRWLDLTFMQLQLDERTEPDAIG
Download sequence
Identical sequences A0A025CBL4 A0A027TJI6 A0A027ZLX7 A0A028E012 A0A029I384 A0A029IVP8 A0A070SL82 A0A0A8U7E6 A0A0E0TZ93 A0A0E0Y134 A0A0E2L5H5 A0A0F6C400 A0A0H2YYX7 A0A0H3EIN8 A0A1E3N0S1 A0A1H0QMX7 A0A1S9KG14 A0A1X3J207 A0A1X3L3V9 A0A1X3LIZ1 A0A1X3LXU3 A0A1Z3V4L8 A0A222QK58 A0A2D0NQC3 A0A2H1BPI3 A0A2I8JH61 B6IAJ4 B7MMT2 B7MUN4 B7N4K6 B7URJ5 C3TAM2 C8UPP4 D3GRI1 D6HWN4 D6I928 D6JAU3 D7XBR4 E2XGL3 E3XVL6 F3V5J0 F5N165 F5NVF2 H4IAR0 H4IR59 H4J7U2 H4KG68 H4LBK0 I2UG81 I6DIL3 K4WBI6 K4XMP0 L3BLS4 L4VTT0 Q32FR0 Q8X9W8 S1PZU0 T6HQE3 T9AEM3 U9ZAC3 V6FV68 V8FGK3
gi|387607034|ref|YP_006095890.1| gi|387616769|ref|YP_006119791.1| gi|556551527|ref|YP_008721656.1| gi|544575927|ref|YP_008571451.1| gi|407482189|ref|YP_006779338.1| gi|117623690|ref|YP_852603.1| 155864.Z2271 300267.SDY_1725 362663.ECP_1450 386585.ECs2052 405955.APECO1_589 409438.ECSE_1531 544404.ECSP_1929 573235.ECO26_2049 574521.E2348C_1589 585035.ECS88_1542 585056.ECUMN_1697 585396.ECO111_1839 585397.ECED1_1602 gi|410482739|ref|YP_006770285.1| gi|254792993|ref|YP_003077830.1| gi|209918722|ref|YP_002292806.1| gi|15801695|ref|NP_287713.1| NP_310079.1.58667 WP_000027563.1.10001 WP_000027563.1.100014 WP_000027563.1.100052 WP_000027563.1.100066 WP_000027563.1.100073 WP_000027563.1.10010 WP_000027563.1.100111 WP_000027563.1.100151 WP_000027563.1.100185 WP_000027563.1.100194 WP_000027563.1.100220 WP_000027563.1.100227 WP_000027563.1.100281 WP_000027563.1.100299 WP_000027563.1.100302 WP_000027563.1.100304 WP_000027563.1.100306 WP_000027563.1.100346 WP_000027563.1.100425 WP_000027563.1.100451 WP_000027563.1.100474 WP_000027563.1.100499 WP_000027563.1.100508 WP_000027563.1.100543 WP_000027563.1.100554 WP_000027563.1.100573 WP_000027563.1.100614 WP_000027563.1.10068 WP_000027563.1.100685 WP_000027563.1.100688 WP_000027563.1.100735 WP_000027563.1.100738 WP_000027563.1.100752 WP_000027563.1.100796 WP_000027563.1.10080 WP_000027563.1.100803 WP_000027563.1.100836 WP_000027563.1.10086 WP_000027563.1.100867 WP_000027563.1.100898 WP_000027563.1.100916 WP_000027563.1.100925 WP_000027563.1.100933 WP_000027563.1.100950 WP_000027563.1.100959 WP_000027563.1.100990 WP_000027563.1.10100 WP_000027563.1.101052 WP_000027563.1.101087 WP_000027563.1.101096 WP_000027563.1.1011 WP_000027563.1.101102 WP_000027563.1.101105 WP_000027563.1.101148 WP_000027563.1.101152 WP_000027563.1.101157 WP_000027563.1.101166 WP_000027563.1.101206 WP_000027563.1.101255 WP_000027563.1.10126 WP_000027563.1.101289 WP_000027563.1.101293 WP_000027563.1.101359 WP_000027563.1.10138 WP_000027563.1.101399 WP_000027563.1.101418 WP_000027563.1.101429 WP_000027563.1.101436 WP_000027563.1.101468 WP_000027563.1.10154 WP_000027563.1.101583 WP_000027563.1.101628 WP_000027563.1.101630 WP_000027563.1.101651 WP_000027563.1.101653 WP_000027563.1.101668 WP_000027563.1.101686 WP_000027563.1.101693 WP_000027563.1.101694 WP_000027563.1.101700 WP_000027563.1.10173 WP_000027563.1.101777 WP_000027563.1.101786 WP_000027563.1.10181 WP_000027563.1.101822 WP_000027563.1.10184 WP_000027563.1.101840 WP_000027563.1.101845 WP_000027563.1.101855 WP_000027563.1.10190 WP_000027563.1.101908 WP_000027563.1.101913 WP_000027563.1.101926 WP_000027563.1.101932 WP_000027563.1.101947 WP_000027563.1.101964 WP_000027563.1.101984 WP_000027563.1.102036 WP_000027563.1.10206 WP_000027563.1.102069 WP_000027563.1.102076 WP_000027563.1.102094 WP_000027563.1.102104 WP_000027563.1.102106 WP_000027563.1.102122 WP_000027563.1.102139 WP_000027563.1.102144 WP_000027563.1.10273 WP_000027563.1.10326 WP_000027563.1.10335 WP_000027563.1.10461 WP_000027563.1.10476 WP_000027563.1.10492 WP_000027563.1.10524 WP_000027563.1.10538 WP_000027563.1.10573 WP_000027563.1.10579 WP_000027563.1.10605 WP_000027563.1.10607 WP_000027563.1.10651 WP_000027563.1.10697 WP_000027563.1.1071 WP_000027563.1.10761 WP_000027563.1.10763 WP_000027563.1.10786 WP_000027563.1.10787 WP_000027563.1.10798 WP_000027563.1.10809 WP_000027563.1.10814 WP_000027563.1.10824 WP_000027563.1.10842 WP_000027563.1.10849 WP_000027563.1.10869 WP_000027563.1.10970 WP_000027563.1.10989 WP_000027563.1.11006 WP_000027563.1.11032 WP_000027563.1.11052 WP_000027563.1.11057 WP_000027563.1.11091 WP_000027563.1.1111 WP_000027563.1.11113 WP_000027563.1.11133 WP_000027563.1.112 WP_000027563.1.11217 WP_000027563.1.1122 WP_000027563.1.11240 WP_000027563.1.11250 WP_000027563.1.11265 WP_000027563.1.11285 WP_000027563.1.11301 WP_000027563.1.11315 WP_000027563.1.11399 WP_000027563.1.11411 WP_000027563.1.11420 WP_000027563.1.11519 WP_000027563.1.11524 WP_000027563.1.11531 WP_000027563.1.11542 WP_000027563.1.11575 WP_000027563.1.11578 WP_000027563.1.11607 WP_000027563.1.11608 WP_000027563.1.11612 WP_000027563.1.11616 WP_000027563.1.11645 WP_000027563.1.11671 WP_000027563.1.1168 WP_000027563.1.11690 WP_000027563.1.11759 WP_000027563.1.11801 WP_000027563.1.1186 WP_000027563.1.11949 WP_000027563.1.12009 WP_000027563.1.12010 WP_000027563.1.12050 WP_000027563.1.12051 WP_000027563.1.12076 WP_000027563.1.12088 WP_000027563.1.12111 WP_000027563.1.12115 WP_000027563.1.12151 WP_000027563.1.12157 WP_000027563.1.12174 WP_000027563.1.12259 WP_000027563.1.12268 WP_000027563.1.12295 WP_000027563.1.12305 WP_000027563.1.12320 WP_000027563.1.12344 WP_000027563.1.1242 WP_000027563.1.12459 WP_000027563.1.12478 WP_000027563.1.12552 WP_000027563.1.12566 WP_000027563.1.12574 WP_000027563.1.12623 WP_000027563.1.12645 WP_000027563.1.12697 WP_000027563.1.12709 WP_000027563.1.12743 WP_000027563.1.12749 WP_000027563.1.1275 WP_000027563.1.12761 WP_000027563.1.12763 WP_000027563.1.12766 WP_000027563.1.1278 WP_000027563.1.12781 WP_000027563.1.12826 WP_000027563.1.12830 WP_000027563.1.12911 WP_000027563.1.12915 WP_000027563.1.12917 WP_000027563.1.1295 WP_000027563.1.12956 WP_000027563.1.12976 WP_000027563.1.12979 WP_000027563.1.12991 WP_000027563.1.13060 WP_000027563.1.13117 WP_000027563.1.1314 WP_000027563.1.13181 WP_000027563.1.13205 WP_000027563.1.13217 WP_000027563.1.13222 WP_000027563.1.13223 WP_000027563.1.1323 WP_000027563.1.13272 WP_000027563.1.13295 WP_000027563.1.13332 WP_000027563.1.13348 WP_000027563.1.13393 WP_000027563.1.1343 WP_000027563.1.13430 WP_000027563.1.13442 WP_000027563.1.13481 WP_000027563.1.13525 WP_000027563.1.13601 WP_000027563.1.13626 WP_000027563.1.13662 WP_000027563.1.13778 WP_000027563.1.13791 WP_000027563.1.13881 WP_000027563.1.13934 WP_000027563.1.13936 WP_000027563.1.13939 WP_000027563.1.13944 WP_000027563.1.14023 WP_000027563.1.14042 WP_000027563.1.14058 WP_000027563.1.14062 WP_000027563.1.14110 WP_000027563.1.14144 WP_000027563.1.14164 WP_000027563.1.1419 WP_000027563.1.14245 WP_000027563.1.14277 WP_000027563.1.14304 WP_000027563.1.14331 WP_000027563.1.14371 WP_000027563.1.14445 WP_000027563.1.14453 WP_000027563.1.14493 WP_000027563.1.14509 WP_000027563.1.14538 WP_000027563.1.14581 WP_000027563.1.14582 WP_000027563.1.14605 WP_000027563.1.14621 WP_000027563.1.14678 WP_000027563.1.14687 WP_000027563.1.14693 WP_000027563.1.14712 WP_000027563.1.14746 WP_000027563.1.14748 WP_000027563.1.14807 WP_000027563.1.14934 WP_000027563.1.14935 WP_000027563.1.15020 WP_000027563.1.15090 WP_000027563.1.15138 WP_000027563.1.15193 WP_000027563.1.1524 WP_000027563.1.15270 WP_000027563.1.15274 WP_000027563.1.15290 WP_000027563.1.15304 WP_000027563.1.15335 WP_000027563.1.15356 WP_000027563.1.1543 WP_000027563.1.15444 WP_000027563.1.15453 WP_000027563.1.15469 WP_000027563.1.1550 WP_000027563.1.15503 WP_000027563.1.15521 WP_000027563.1.15527 WP_000027563.1.15528 WP_000027563.1.1559 WP_000027563.1.15593 WP_000027563.1.15600 WP_000027563.1.1561 WP_000027563.1.15624 WP_000027563.1.15626 WP_000027563.1.15654 WP_000027563.1.15702 WP_000027563.1.15707 WP_000027563.1.15731 WP_000027563.1.15782 WP_000027563.1.15809 WP_000027563.1.1582 WP_000027563.1.15857 WP_000027563.1.15863 WP_000027563.1.15869 WP_000027563.1.15906 WP_000027563.1.15916 WP_000027563.1.15945 WP_000027563.1.15951 WP_000027563.1.15984 WP_000027563.1.1604 WP_000027563.1.16067 WP_000027563.1.16075 WP_000027563.1.16087 WP_000027563.1.16117 WP_000027563.1.16131 WP_000027563.1.16133 WP_000027563.1.16175 WP_000027563.1.16194 WP_000027563.1.1622 WP_000027563.1.16222 WP_000027563.1.16270 WP_000027563.1.16272 WP_000027563.1.16388 WP_000027563.1.16396 WP_000027563.1.1640 WP_000027563.1.16463 WP_000027563.1.16481 WP_000027563.1.16517 WP_000027563.1.16539 WP_000027563.1.16608 WP_000027563.1.16648 WP_000027563.1.16685 WP_000027563.1.16705 WP_000027563.1.1673 WP_000027563.1.16745 WP_000027563.1.16780 WP_000027563.1.16798 WP_000027563.1.16799 WP_000027563.1.16807 WP_000027563.1.16845 WP_000027563.1.16927 WP_000027563.1.16979 WP_000027563.1.17014 WP_000027563.1.17028 WP_000027563.1.17061 WP_000027563.1.1710 WP_000027563.1.17109 WP_000027563.1.17123 WP_000027563.1.17153 WP_000027563.1.17172 WP_000027563.1.17182 WP_000027563.1.17187 WP_000027563.1.17206 WP_000027563.1.17216 WP_000027563.1.1731 WP_000027563.1.17325 WP_000027563.1.17356 WP_000027563.1.17373 WP_000027563.1.17386 WP_000027563.1.17387 WP_000027563.1.17403 WP_000027563.1.17410 WP_000027563.1.17415 WP_000027563.1.17461 WP_000027563.1.17464 WP_000027563.1.17496 WP_000027563.1.17515 WP_000027563.1.17568 WP_000027563.1.17584 WP_000027563.1.17595 WP_000027563.1.17623 WP_000027563.1.17637 WP_000027563.1.1766 WP_000027563.1.1769 WP_000027563.1.1772 WP_000027563.1.17802 WP_000027563.1.17829 WP_000027563.1.17849 WP_000027563.1.17904 WP_000027563.1.17925 WP_000027563.1.17961 WP_000027563.1.17963 WP_000027563.1.17984 WP_000027563.1.1802 WP_000027563.1.18024 WP_000027563.1.18094 WP_000027563.1.18112 WP_000027563.1.18136 WP_000027563.1.18141 WP_000027563.1.1821 WP_000027563.1.18275 WP_000027563.1.18326 WP_000027563.1.18337 WP_000027563.1.18338 WP_000027563.1.1834 WP_000027563.1.18340 WP_000027563.1.18348 WP_000027563.1.18383 WP_000027563.1.18394 WP_000027563.1.18436 WP_000027563.1.18438 WP_000027563.1.18458 WP_000027563.1.18461 WP_000027563.1.18482 WP_000027563.1.18556 WP_000027563.1.18581 WP_000027563.1.1861 WP_000027563.1.1862 WP_000027563.1.18714 WP_000027563.1.18802 WP_000027563.1.1881 WP_000027563.1.18828 WP_000027563.1.18837 WP_000027563.1.18843 WP_000027563.1.18861 WP_000027563.1.18874 WP_000027563.1.18908 WP_000027563.1.18934 WP_000027563.1.18936 WP_000027563.1.18962 WP_000027563.1.18983 WP_000027563.1.18995 WP_000027563.1.19036 WP_000027563.1.19039 WP_000027563.1.19090 WP_000027563.1.191 WP_000027563.1.19135 WP_000027563.1.19140 WP_000027563.1.19146 WP_000027563.1.19147 WP_000027563.1.19150 WP_000027563.1.19153 WP_000027563.1.19171 WP_000027563.1.19194 WP_000027563.1.19245 WP_000027563.1.1925 WP_000027563.1.19276 WP_000027563.1.19312 WP_000027563.1.19332 WP_000027563.1.19350 WP_000027563.1.19379 WP_000027563.1.19389 WP_000027563.1.19419 WP_000027563.1.19424 WP_000027563.1.19448 WP_000027563.1.19465 WP_000027563.1.19492 WP_000027563.1.19494 WP_000027563.1.1952 WP_000027563.1.19534 WP_000027563.1.19544 WP_000027563.1.19547 WP_000027563.1.19557 WP_000027563.1.19581 WP_000027563.1.19583 WP_000027563.1.19593 WP_000027563.1.1960 WP_000027563.1.19644 WP_000027563.1.19649 WP_000027563.1.19654 WP_000027563.1.19661 WP_000027563.1.19684 WP_000027563.1.19761 WP_000027563.1.19830 WP_000027563.1.19840 WP_000027563.1.19847 WP_000027563.1.1987 WP_000027563.1.19972 WP_000027563.1.2005 WP_000027563.1.20114 WP_000027563.1.20115 WP_000027563.1.20136 WP_000027563.1.20159 WP_000027563.1.20166 WP_000027563.1.20215 WP_000027563.1.20224 WP_000027563.1.20238 WP_000027563.1.20264 WP_000027563.1.2027 WP_000027563.1.20289 WP_000027563.1.20334 WP_000027563.1.20449 WP_000027563.1.20452 WP_000027563.1.20480 WP_000027563.1.20483 WP_000027563.1.20519 WP_000027563.1.20546 WP_000027563.1.20565 WP_000027563.1.20575 WP_000027563.1.20594 WP_000027563.1.20609 WP_000027563.1.20640 WP_000027563.1.20709 WP_000027563.1.20730 WP_000027563.1.20741 WP_000027563.1.20745 WP_000027563.1.2075 WP_000027563.1.20761 WP_000027563.1.20765 WP_000027563.1.20784 WP_000027563.1.20803 WP_000027563.1.20824 WP_000027563.1.20848 WP_000027563.1.2089 WP_000027563.1.20893 WP_000027563.1.20933 WP_000027563.1.20941 WP_000027563.1.20950 WP_000027563.1.20962 WP_000027563.1.20989 WP_000027563.1.21029 WP_000027563.1.21041 WP_000027563.1.21104 WP_000027563.1.21137 WP_000027563.1.21152 WP_000027563.1.21236 WP_000027563.1.21255 WP_000027563.1.21266 WP_000027563.1.21320 WP_000027563.1.21378 WP_000027563.1.21441 WP_000027563.1.21450 WP_000027563.1.21455 WP_000027563.1.21508 WP_000027563.1.21537 WP_000027563.1.21596 WP_000027563.1.21614 WP_000027563.1.21634 WP_000027563.1.21652 WP_000027563.1.21666 WP_000027563.1.21667 WP_000027563.1.21668 WP_000027563.1.21696 WP_000027563.1.21714 WP_000027563.1.21729 WP_000027563.1.21732 WP_000027563.1.21773 WP_000027563.1.21899 WP_000027563.1.21962 WP_000027563.1.2198 WP_000027563.1.22042 WP_000027563.1.22088 WP_000027563.1.22098 WP_000027563.1.22161 WP_000027563.1.2218 WP_000027563.1.22189 WP_000027563.1.22203 WP_000027563.1.22204 WP_000027563.1.22251 WP_000027563.1.22272 WP_000027563.1.22291 WP_000027563.1.22293 WP_000027563.1.22304 WP_000027563.1.22381 WP_000027563.1.2242 WP_000027563.1.22431 WP_000027563.1.2245 WP_000027563.1.22464 WP_000027563.1.22508 WP_000027563.1.22543 WP_000027563.1.22544 WP_000027563.1.22549 WP_000027563.1.22576 WP_000027563.1.22594 WP_000027563.1.22667 WP_000027563.1.22685 WP_000027563.1.22743 WP_000027563.1.22757 WP_000027563.1.22759 WP_000027563.1.22814 WP_000027563.1.22824 WP_000027563.1.22868 WP_000027563.1.22917 WP_000027563.1.22925 WP_000027563.1.22939 WP_000027563.1.22988 WP_000027563.1.22993 WP_000027563.1.2300 WP_000027563.1.23005 WP_000027563.1.23021 WP_000027563.1.23073 WP_000027563.1.23078 WP_000027563.1.23092 WP_000027563.1.23109 WP_000027563.1.23115 WP_000027563.1.23230 WP_000027563.1.23241 WP_000027563.1.23282 WP_000027563.1.23290 WP_000027563.1.23299 WP_000027563.1.23323 WP_000027563.1.23355 WP_000027563.1.23383 WP_000027563.1.23386 WP_000027563.1.23393 WP_000027563.1.23467 WP_000027563.1.23487 WP_000027563.1.23522 WP_000027563.1.23527 WP_000027563.1.23575 WP_000027563.1.23593 WP_000027563.1.23640 WP_000027563.1.23686 WP_000027563.1.23693 WP_000027563.1.23700 WP_000027563.1.23741 WP_000027563.1.23752 WP_000027563.1.23754 WP_000027563.1.23790 WP_000027563.1.23806 WP_000027563.1.23838 WP_000027563.1.23840 WP_000027563.1.23855 WP_000027563.1.2388 WP_000027563.1.23890 WP_000027563.1.23895 WP_000027563.1.23899 WP_000027563.1.23962 WP_000027563.1.23973 WP_000027563.1.23984 WP_000027563.1.24004 WP_000027563.1.24024 WP_000027563.1.24038 WP_000027563.1.24070 WP_000027563.1.24089 WP_000027563.1.24127 WP_000027563.1.2413 WP_000027563.1.24136 WP_000027563.1.24169 WP_000027563.1.24177 WP_000027563.1.24283 WP_000027563.1.24341 WP_000027563.1.24383 WP_000027563.1.24460 WP_000027563.1.24473 WP_000027563.1.24483 WP_000027563.1.2449 WP_000027563.1.24524 WP_000027563.1.24536 WP_000027563.1.24575 WP_000027563.1.24592 WP_000027563.1.24646 WP_000027563.1.2469 WP_000027563.1.24695 WP_000027563.1.24753 WP_000027563.1.24773 WP_000027563.1.24797 WP_000027563.1.24849 WP_000027563.1.24854 WP_000027563.1.24870 WP_000027563.1.24876 WP_000027563.1.24906 WP_000027563.1.24909 WP_000027563.1.24926 WP_000027563.1.24968 WP_000027563.1.24979 WP_000027563.1.24984 WP_000027563.1.25019 WP_000027563.1.2502 WP_000027563.1.25021 WP_000027563.1.25039 WP_000027563.1.2504 WP_000027563.1.25076 WP_000027563.1.25079 WP_000027563.1.25082 WP_000027563.1.25088 WP_000027563.1.2512 WP_000027563.1.25174 WP_000027563.1.25201 WP_000027563.1.25204 WP_000027563.1.25248 WP_000027563.1.25270 WP_000027563.1.25305 WP_000027563.1.25324 WP_000027563.1.25372 WP_000027563.1.25378 WP_000027563.1.25380 WP_000027563.1.2540 WP_000027563.1.25420 WP_000027563.1.25446 WP_000027563.1.25480 WP_000027563.1.25526 WP_000027563.1.25577 WP_000027563.1.25592 WP_000027563.1.25612 WP_000027563.1.25613 WP_000027563.1.2567 WP_000027563.1.25680 WP_000027563.1.25701 WP_000027563.1.25712 WP_000027563.1.25726 WP_000027563.1.25750 WP_000027563.1.25794 WP_000027563.1.25819 WP_000027563.1.25831 WP_000027563.1.25869 WP_000027563.1.25873 WP_000027563.1.25886 WP_000027563.1.25890 WP_000027563.1.25895 WP_000027563.1.25945 WP_000027563.1.26040 WP_000027563.1.26055 WP_000027563.1.2606 WP_000027563.1.26066 WP_000027563.1.26076 WP_000027563.1.26092 WP_000027563.1.26100 WP_000027563.1.26105 WP_000027563.1.26121 WP_000027563.1.26130 WP_000027563.1.26131 WP_000027563.1.26134 WP_000027563.1.26161 WP_000027563.1.26175 WP_000027563.1.26186 WP_000027563.1.26189 WP_000027563.1.26191 WP_000027563.1.26246 WP_000027563.1.26259 WP_000027563.1.26262 WP_000027563.1.26270 WP_000027563.1.26284 WP_000027563.1.26304 WP_000027563.1.26325 WP_000027563.1.2637 WP_000027563.1.26391 WP_000027563.1.26398 WP_000027563.1.2642 WP_000027563.1.26438 WP_000027563.1.26443 WP_000027563.1.26474 WP_000027563.1.26525 WP_000027563.1.26574 WP_000027563.1.26579 WP_000027563.1.26588 WP_000027563.1.26590 WP_000027563.1.26613 WP_000027563.1.26627 WP_000027563.1.26659 WP_000027563.1.26660 WP_000027563.1.26683 WP_000027563.1.26688 WP_000027563.1.26716 WP_000027563.1.26761 WP_000027563.1.26782 WP_000027563.1.26837 WP_000027563.1.26839 WP_000027563.1.26861 WP_000027563.1.26878 WP_000027563.1.2688 WP_000027563.1.26912 WP_000027563.1.26932 WP_000027563.1.2695 WP_000027563.1.26950 WP_000027563.1.26975 WP_000027563.1.26987 WP_000027563.1.26995 WP_000027563.1.26998 WP_000027563.1.2700 WP_000027563.1.27019 WP_000027563.1.27043 WP_000027563.1.27060 WP_000027563.1.27091 WP_000027563.1.2712 WP_000027563.1.27141 WP_000027563.1.27148 WP_000027563.1.27287 WP_000027563.1.27292 WP_000027563.1.2731 WP_000027563.1.27310 WP_000027563.1.27330 WP_000027563.1.27338 WP_000027563.1.27396 WP_000027563.1.27401 WP_000027563.1.27424 WP_000027563.1.27445 WP_000027563.1.2745 WP_000027563.1.27518 WP_000027563.1.27520 WP_000027563.1.27618 WP_000027563.1.27734 WP_000027563.1.27742 WP_000027563.1.27758 WP_000027563.1.2779 WP_000027563.1.27846 WP_000027563.1.27856 WP_000027563.1.27861 WP_000027563.1.27871 WP_000027563.1.27876 WP_000027563.1.27897 WP_000027563.1.27913 WP_000027563.1.27932 WP_000027563.1.2794 WP_000027563.1.27998 WP_000027563.1.28008 WP_000027563.1.28026 WP_000027563.1.28027 WP_000027563.1.28051 WP_000027563.1.28102 WP_000027563.1.28110 WP_000027563.1.28143 WP_000027563.1.28156 WP_000027563.1.28167 WP_000027563.1.28199 WP_000027563.1.28318 WP_000027563.1.28345 WP_000027563.1.28349 WP_000027563.1.2838 WP_000027563.1.28461 WP_000027563.1.28476 WP_000027563.1.285 WP_000027563.1.28551 WP_000027563.1.28554 WP_000027563.1.28568 WP_000027563.1.28639 WP_000027563.1.2866 WP_000027563.1.28683 WP_000027563.1.28723 WP_000027563.1.28732 WP_000027563.1.28734 WP_000027563.1.28736 WP_000027563.1.28742 WP_000027563.1.28760 WP_000027563.1.2881 WP_000027563.1.28829 WP_000027563.1.28842 WP_000027563.1.28879 WP_000027563.1.29001 WP_000027563.1.29016 WP_000027563.1.29049 WP_000027563.1.29082 WP_000027563.1.291 WP_000027563.1.29118 WP_000027563.1.29125 WP_000027563.1.29126 WP_000027563.1.29150 WP_000027563.1.29194 WP_000027563.1.29206 WP_000027563.1.29258 WP_000027563.1.29341 WP_000027563.1.29377 WP_000027563.1.29394 WP_000027563.1.29404 WP_000027563.1.2942 WP_000027563.1.29495 WP_000027563.1.29504 WP_000027563.1.29513 WP_000027563.1.29523 WP_000027563.1.29564 WP_000027563.1.29597 WP_000027563.1.29618 WP_000027563.1.2963 WP_000027563.1.29647 WP_000027563.1.29662 WP_000027563.1.29669 WP_000027563.1.2978 WP_000027563.1.29798 WP_000027563.1.29815 WP_000027563.1.29818 WP_000027563.1.29819 WP_000027563.1.29820 WP_000027563.1.29855 WP_000027563.1.29874 WP_000027563.1.29876 WP_000027563.1.2995 WP_000027563.1.29967 WP_000027563.1.29976 WP_000027563.1.29979 WP_000027563.1.29988 WP_000027563.1.30 WP_000027563.1.30004 WP_000027563.1.30019 WP_000027563.1.30035 WP_000027563.1.30052 WP_000027563.1.30063 WP_000027563.1.30064 WP_000027563.1.30164 WP_000027563.1.3018 WP_000027563.1.30232 WP_000027563.1.30239 WP_000027563.1.30269 WP_000027563.1.30298 WP_000027563.1.30399 WP_000027563.1.30400 WP_000027563.1.30428 WP_000027563.1.30447 WP_000027563.1.30452 WP_000027563.1.30476 WP_000027563.1.30524 WP_000027563.1.30536 WP_000027563.1.3055 WP_000027563.1.30550 WP_000027563.1.30570 WP_000027563.1.30637 WP_000027563.1.30658 WP_000027563.1.30665 WP_000027563.1.30691 WP_000027563.1.30733 WP_000027563.1.30742 WP_000027563.1.30808 WP_000027563.1.3083 WP_000027563.1.30853 WP_000027563.1.30867 WP_000027563.1.30879 WP_000027563.1.30887 WP_000027563.1.30896 WP_000027563.1.309 WP_000027563.1.30905 WP_000027563.1.30918 WP_000027563.1.30993 WP_000027563.1.30999 WP_000027563.1.31017 WP_000027563.1.31055 WP_000027563.1.31119 WP_000027563.1.31129 WP_000027563.1.31149 WP_000027563.1.312 WP_000027563.1.31252 WP_000027563.1.31295 WP_000027563.1.31319 WP_000027563.1.31340 WP_000027563.1.31347 WP_000027563.1.31357 WP_000027563.1.3140 WP_000027563.1.31401 WP_000027563.1.31419 WP_000027563.1.31422 WP_000027563.1.31429 WP_000027563.1.3147 WP_000027563.1.31511 WP_000027563.1.31518 WP_000027563.1.31521 WP_000027563.1.31542 WP_000027563.1.31557 WP_000027563.1.31559 WP_000027563.1.31575 WP_000027563.1.31596 WP_000027563.1.31657 WP_000027563.1.31675 WP_000027563.1.31709 WP_000027563.1.31715 WP_000027563.1.31803 WP_000027563.1.31809 WP_000027563.1.31823 WP_000027563.1.31825 WP_000027563.1.31835 WP_000027563.1.31860 WP_000027563.1.31863 WP_000027563.1.31866 WP_000027563.1.31924 WP_000027563.1.31956 WP_000027563.1.32020 WP_000027563.1.32021 WP_000027563.1.32024 WP_000027563.1.32063 WP_000027563.1.32089 WP_000027563.1.32091 WP_000027563.1.32142 WP_000027563.1.322 WP_000027563.1.32225 WP_000027563.1.32243 WP_000027563.1.32287 WP_000027563.1.3233 WP_000027563.1.32432 WP_000027563.1.32443 WP_000027563.1.3247 WP_000027563.1.32475 WP_000027563.1.32478 WP_000027563.1.32480 WP_000027563.1.32494 WP_000027563.1.32518 WP_000027563.1.32536 WP_000027563.1.32574 WP_000027563.1.32587 WP_000027563.1.3259 WP_000027563.1.32590 WP_000027563.1.32650 WP_000027563.1.32655 WP_000027563.1.32680 WP_000027563.1.3269 WP_000027563.1.32709 WP_000027563.1.32718 WP_000027563.1.32748 WP_000027563.1.32772 WP_000027563.1.32811 WP_000027563.1.32815 WP_000027563.1.32831 WP_000027563.1.32888 WP_000027563.1.32910 WP_000027563.1.32931 WP_000027563.1.3295 WP_000027563.1.32959 WP_000027563.1.32995 WP_000027563.1.33046 WP_000027563.1.33049 WP_000027563.1.33055 WP_000027563.1.33094 WP_000027563.1.33101 WP_000027563.1.33119 WP_000027563.1.33125 WP_000027563.1.33146 WP_000027563.1.33167 WP_000027563.1.33178 WP_000027563.1.33190 WP_000027563.1.33217 WP_000027563.1.33222 WP_000027563.1.33268 WP_000027563.1.33303 WP_000027563.1.33341 WP_000027563.1.33352 WP_000027563.1.33369 WP_000027563.1.33410 WP_000027563.1.3344 WP_000027563.1.33512 WP_000027563.1.3354 WP_000027563.1.33563 WP_000027563.1.33584 WP_000027563.1.33638 WP_000027563.1.33667 WP_000027563.1.33680 WP_000027563.1.33745 WP_000027563.1.33914 WP_000027563.1.33948 WP_000027563.1.33981 WP_000027563.1.3411 WP_000027563.1.34117 WP_000027563.1.34121 WP_000027563.1.34122 WP_000027563.1.34130 WP_000027563.1.34144 WP_000027563.1.34204 WP_000027563.1.34208 WP_000027563.1.34224 WP_000027563.1.34269 WP_000027563.1.34273 WP_000027563.1.34294 WP_000027563.1.34303 WP_000027563.1.3432 WP_000027563.1.34348 WP_000027563.1.34362 WP_000027563.1.34383 WP_000027563.1.3439 WP_000027563.1.34397 WP_000027563.1.34422 WP_000027563.1.3444 WP_000027563.1.34441 WP_000027563.1.34470 WP_000027563.1.34500 WP_000027563.1.34528 WP_000027563.1.34558 WP_000027563.1.3460 WP_000027563.1.34617 WP_000027563.1.34675 WP_000027563.1.34680 WP_000027563.1.34682 WP_000027563.1.34683 WP_000027563.1.34686 WP_000027563.1.3469 WP_000027563.1.347 WP_000027563.1.34763 WP_000027563.1.34835 WP_000027563.1.34838 WP_000027563.1.34855 WP_000027563.1.34875 WP_000027563.1.34887 WP_000027563.1.34913 WP_000027563.1.34931 WP_000027563.1.35006 WP_000027563.1.35007 WP_000027563.1.35107 WP_000027563.1.35127 WP_000027563.1.35132 WP_000027563.1.35168 WP_000027563.1.35198 WP_000027563.1.35208 WP_000027563.1.35253 WP_000027563.1.35258 WP_000027563.1.35316 WP_000027563.1.35328 WP_000027563.1.35349 WP_000027563.1.35365 WP_000027563.1.3539 WP_000027563.1.35393 WP_000027563.1.35394 WP_000027563.1.35465 WP_000027563.1.3550 WP_000027563.1.35552 WP_000027563.1.35578 WP_000027563.1.35604 WP_000027563.1.35627 WP_000027563.1.35632 WP_000027563.1.35653 WP_000027563.1.35741 WP_000027563.1.35889 WP_000027563.1.35927 WP_000027563.1.35942 WP_000027563.1.35963 WP_000027563.1.35987 WP_000027563.1.3600 WP_000027563.1.36010 WP_000027563.1.36042 WP_000027563.1.36070 WP_000027563.1.36085 WP_000027563.1.36105 WP_000027563.1.36132 WP_000027563.1.36158 WP_000027563.1.36166 WP_000027563.1.36177 WP_000027563.1.36207 WP_000027563.1.36212 WP_000027563.1.3624 WP_000027563.1.36405 WP_000027563.1.36412 WP_000027563.1.36414 WP_000027563.1.36426 WP_000027563.1.3643 WP_000027563.1.36459 WP_000027563.1.365 WP_000027563.1.36500 WP_000027563.1.36545 WP_000027563.1.36610 WP_000027563.1.36626 WP_000027563.1.36627 WP_000027563.1.36628 WP_000027563.1.36667 WP_000027563.1.3668 WP_000027563.1.36707 WP_000027563.1.36761 WP_000027563.1.36767 WP_000027563.1.36799 WP_000027563.1.36812 WP_000027563.1.36833 WP_000027563.1.36856 WP_000027563.1.36886 WP_000027563.1.3697 WP_000027563.1.36975 WP_000027563.1.37032 WP_000027563.1.37046 WP_000027563.1.37102 WP_000027563.1.37103 WP_000027563.1.37226 WP_000027563.1.37266 WP_000027563.1.37306 WP_000027563.1.37312 WP_000027563.1.37313 WP_000027563.1.37334 WP_000027563.1.37337 WP_000027563.1.37342 WP_000027563.1.37372 WP_000027563.1.37388 WP_000027563.1.37423 WP_000027563.1.37472 WP_000027563.1.37477 WP_000027563.1.37510 WP_000027563.1.37544 WP_000027563.1.37548 WP_000027563.1.37550 WP_000027563.1.37554 WP_000027563.1.37592 WP_000027563.1.37608 WP_000027563.1.3762 WP_000027563.1.37664 WP_000027563.1.377 WP_000027563.1.3772 WP_000027563.1.37731 WP_000027563.1.37736 WP_000027563.1.37766 WP_000027563.1.37769 WP_000027563.1.37773 WP_000027563.1.37830 WP_000027563.1.37887 WP_000027563.1.37917 WP_000027563.1.37926 WP_000027563.1.3795 WP_000027563.1.37962 WP_000027563.1.37984 WP_000027563.1.37995 WP_000027563.1.37998 WP_000027563.1.38000 WP_000027563.1.38033 WP_000027563.1.38050 WP_000027563.1.38063 WP_000027563.1.38081 WP_000027563.1.38085 WP_000027563.1.38103 WP_000027563.1.38107 WP_000027563.1.38120 WP_000027563.1.38162 WP_000027563.1.38194 WP_000027563.1.3822 WP_000027563.1.38257 WP_000027563.1.38293 WP_000027563.1.38300 WP_000027563.1.38306 WP_000027563.1.38314 WP_000027563.1.38369 WP_000027563.1.38392 WP_000027563.1.38412 WP_000027563.1.38485 WP_000027563.1.38561 WP_000027563.1.38626 WP_000027563.1.38722 WP_000027563.1.3873 WP_000027563.1.38751 WP_000027563.1.38782 WP_000027563.1.38811 WP_000027563.1.38835 WP_000027563.1.389 WP_000027563.1.38911 WP_000027563.1.38937 WP_000027563.1.38958 WP_000027563.1.39005 WP_000027563.1.39037 WP_000027563.1.3904 WP_000027563.1.39042 WP_000027563.1.39103 WP_000027563.1.3912 WP_000027563.1.39123 WP_000027563.1.39148 WP_000027563.1.39150 WP_000027563.1.39171 WP_000027563.1.39180 WP_000027563.1.39209 WP_000027563.1.3922 WP_000027563.1.39232 WP_000027563.1.39268 WP_000027563.1.39286 WP_000027563.1.39289 WP_000027563.1.39310 WP_000027563.1.39313 WP_000027563.1.39325 WP_000027563.1.39327 WP_000027563.1.39367 WP_000027563.1.39377 WP_000027563.1.39401 WP_000027563.1.39415 WP_000027563.1.39423 WP_000027563.1.39481 WP_000027563.1.3954 WP_000027563.1.39564 WP_000027563.1.39575 WP_000027563.1.39594 WP_000027563.1.39601 WP_000027563.1.39607 WP_000027563.1.39610 WP_000027563.1.39646 WP_000027563.1.39651 WP_000027563.1.39690 WP_000027563.1.3970 WP_000027563.1.39708 WP_000027563.1.39709 WP_000027563.1.39713 WP_000027563.1.39717 WP_000027563.1.39726 WP_000027563.1.39734 WP_000027563.1.39758 WP_000027563.1.39809 WP_000027563.1.39818 WP_000027563.1.39820 WP_000027563.1.39867 WP_000027563.1.39892 WP_000027563.1.39961 WP_000027563.1.40019 WP_000027563.1.4005 WP_000027563.1.40083 WP_000027563.1.40088 WP_000027563.1.40107 WP_000027563.1.40113 WP_000027563.1.40153 WP_000027563.1.40190 WP_000027563.1.40206 WP_000027563.1.40211 WP_000027563.1.40234 WP_000027563.1.40249 WP_000027563.1.40298 WP_000027563.1.4030 WP_000027563.1.40300 WP_000027563.1.40315 WP_000027563.1.40319 WP_000027563.1.40335 WP_000027563.1.40345 WP_000027563.1.40349 WP_000027563.1.40360 WP_000027563.1.40382 WP_000027563.1.40403 WP_000027563.1.40486 WP_000027563.1.4049 WP_000027563.1.40502 WP_000027563.1.40509 WP_000027563.1.40549 WP_000027563.1.40560 WP_000027563.1.40563 WP_000027563.1.40599 WP_000027563.1.40607 WP_000027563.1.40629 WP_000027563.1.40636 WP_000027563.1.40657 WP_000027563.1.40660 WP_000027563.1.40715 WP_000027563.1.40742 WP_000027563.1.40758 WP_000027563.1.40793 WP_000027563.1.40813 WP_000027563.1.40843 WP_000027563.1.40865 WP_000027563.1.40882 WP_000027563.1.40893 WP_000027563.1.40900 WP_000027563.1.40952 WP_000027563.1.4103 WP_000027563.1.41041 WP_000027563.1.41045 WP_000027563.1.41060 WP_000027563.1.41063 WP_000027563.1.41078 WP_000027563.1.41113 WP_000027563.1.41125 WP_000027563.1.41147 WP_000027563.1.4122 WP_000027563.1.41263 WP_000027563.1.41294 WP_000027563.1.41315 WP_000027563.1.41330 WP_000027563.1.41332 WP_000027563.1.41363 WP_000027563.1.41372 WP_000027563.1.41392 WP_000027563.1.41401 WP_000027563.1.41407 WP_000027563.1.4142 WP_000027563.1.41453 WP_000027563.1.41455 WP_000027563.1.41466 WP_000027563.1.41478 WP_000027563.1.41482 WP_000027563.1.41484 WP_000027563.1.41488 WP_000027563.1.41536 WP_000027563.1.41539 WP_000027563.1.41545 WP_000027563.1.41566 WP_000027563.1.4158 WP_000027563.1.41613 WP_000027563.1.41654 WP_000027563.1.41734 WP_000027563.1.41752 WP_000027563.1.41782 WP_000027563.1.41783 WP_000027563.1.41809 WP_000027563.1.41822 WP_000027563.1.41847 WP_000027563.1.41849 WP_000027563.1.41884 WP_000027563.1.4189 WP_000027563.1.41923 WP_000027563.1.41990 WP_000027563.1.41991 WP_000027563.1.42027 WP_000027563.1.42036 WP_000027563.1.42038 WP_000027563.1.42044 WP_000027563.1.4213 WP_000027563.1.42138 WP_000027563.1.4214 WP_000027563.1.42151 WP_000027563.1.42191 WP_000027563.1.42203 WP_000027563.1.42226 WP_000027563.1.42228 WP_000027563.1.4224 WP_000027563.1.42252 WP_000027563.1.42258 WP_000027563.1.42350 WP_000027563.1.42387 WP_000027563.1.42413 WP_000027563.1.42432 WP_000027563.1.42442 WP_000027563.1.42443 WP_000027563.1.42447 WP_000027563.1.4250 WP_000027563.1.42513 WP_000027563.1.42586 WP_000027563.1.42594 WP_000027563.1.42597 WP_000027563.1.42600 WP_000027563.1.42601 WP_000027563.1.4261 WP_000027563.1.42632 WP_000027563.1.42638 WP_000027563.1.42669 WP_000027563.1.42670 WP_000027563.1.42677 WP_000027563.1.42709 WP_000027563.1.42748 WP_000027563.1.42804 WP_000027563.1.42813 WP_000027563.1.42832 WP_000027563.1.42863 WP_000027563.1.42891 WP_000027563.1.42936 WP_000027563.1.42962 WP_000027563.1.42970 WP_000027563.1.42975 WP_000027563.1.42991 WP_000027563.1.43013 WP_000027563.1.43027 WP_000027563.1.43079 WP_000027563.1.43121 WP_000027563.1.43123 WP_000027563.1.4313 WP_000027563.1.43133 WP_000027563.1.43137 WP_000027563.1.43140 WP_000027563.1.43166 WP_000027563.1.43174 WP_000027563.1.43177 WP_000027563.1.43196 WP_000027563.1.43239 WP_000027563.1.43278 WP_000027563.1.43316 WP_000027563.1.43363 WP_000027563.1.43384 WP_000027563.1.4342 WP_000027563.1.43422 WP_000027563.1.43427 WP_000027563.1.4343 WP_000027563.1.43448 WP_000027563.1.43469 WP_000027563.1.43474 WP_000027563.1.43501 WP_000027563.1.43536 WP_000027563.1.4356 WP_000027563.1.436 WP_000027563.1.43604 WP_000027563.1.43733 WP_000027563.1.43738 WP_000027563.1.43754 WP_000027563.1.43769 WP_000027563.1.43798 WP_000027563.1.43803 WP_000027563.1.43816 WP_000027563.1.43837 WP_000027563.1.43858 WP_000027563.1.43868 WP_000027563.1.43898 WP_000027563.1.43911 WP_000027563.1.43939 WP_000027563.1.43942 WP_000027563.1.43953 WP_000027563.1.440 WP_000027563.1.44018 WP_000027563.1.44029 WP_000027563.1.44040 WP_000027563.1.44051 WP_000027563.1.44075 WP_000027563.1.44077 WP_000027563.1.44125 WP_000027563.1.4415 WP_000027563.1.44165 WP_000027563.1.44203 WP_000027563.1.44238 WP_000027563.1.44251 WP_000027563.1.44263 WP_000027563.1.44273 WP_000027563.1.44285 WP_000027563.1.44327 WP_000027563.1.44389 WP_000027563.1.44445 WP_000027563.1.44447 WP_000027563.1.44460 WP_000027563.1.44488 WP_000027563.1.4449 WP_000027563.1.44524 WP_000027563.1.4454 WP_000027563.1.44561 WP_000027563.1.4459 WP_000027563.1.44622 WP_000027563.1.44649 WP_000027563.1.44661 WP_000027563.1.4471 WP_000027563.1.44717 WP_000027563.1.44733 WP_000027563.1.44756 WP_000027563.1.44843 WP_000027563.1.44855 WP_000027563.1.44906 WP_000027563.1.44954 WP_000027563.1.44977 WP_000027563.1.45000 WP_000027563.1.45020 WP_000027563.1.45028 WP_000027563.1.45043 WP_000027563.1.45053 WP_000027563.1.45076 WP_000027563.1.45153 WP_000027563.1.45190 WP_000027563.1.45195 WP_000027563.1.45293 WP_000027563.1.4530 WP_000027563.1.45359 WP_000027563.1.4538 WP_000027563.1.45404 WP_000027563.1.45405 WP_000027563.1.4541 WP_000027563.1.45525 WP_000027563.1.45536 WP_000027563.1.45565 WP_000027563.1.45575 WP_000027563.1.45627 WP_000027563.1.45664 WP_000027563.1.45674 WP_000027563.1.45676 WP_000027563.1.45707 WP_000027563.1.45718 WP_000027563.1.45740 WP_000027563.1.4576 WP_000027563.1.45789 WP_000027563.1.45793 WP_000027563.1.45801 WP_000027563.1.4583 WP_000027563.1.45840 WP_000027563.1.45841 WP_000027563.1.45868 WP_000027563.1.45891 WP_000027563.1.45901 WP_000027563.1.45921 WP_000027563.1.45941 WP_000027563.1.45960 WP_000027563.1.45968 WP_000027563.1.45990 WP_000027563.1.46016 WP_000027563.1.46039 WP_000027563.1.46049 WP_000027563.1.46070 WP_000027563.1.46105 WP_000027563.1.4613 WP_000027563.1.46164 WP_000027563.1.4619 WP_000027563.1.46197 WP_000027563.1.46217 WP_000027563.1.46257 WP_000027563.1.46263 WP_000027563.1.46282 WP_000027563.1.46283 WP_000027563.1.46291 WP_000027563.1.46301 WP_000027563.1.46329 WP_000027563.1.46369 WP_000027563.1.46378 WP_000027563.1.46414 WP_000027563.1.46433 WP_000027563.1.46438 WP_000027563.1.46451 WP_000027563.1.4647 WP_000027563.1.46477 WP_000027563.1.46487 WP_000027563.1.46503 WP_000027563.1.46531 WP_000027563.1.46555 WP_000027563.1.46589 WP_000027563.1.46597 WP_000027563.1.46611 WP_000027563.1.46614 WP_000027563.1.46616 WP_000027563.1.46626 WP_000027563.1.46668 WP_000027563.1.46795 WP_000027563.1.46798 WP_000027563.1.46806 WP_000027563.1.46810 WP_000027563.1.46821 WP_000027563.1.46832 WP_000027563.1.46833 WP_000027563.1.46841 WP_000027563.1.46860 WP_000027563.1.46898 WP_000027563.1.4691 WP_000027563.1.46912 WP_000027563.1.46913 WP_000027563.1.4695 WP_000027563.1.46990 WP_000027563.1.47024 WP_000027563.1.47028 WP_000027563.1.47034 WP_000027563.1.47039 WP_000027563.1.47047 WP_000027563.1.47050 WP_000027563.1.47054 WP_000027563.1.47069 WP_000027563.1.47073 WP_000027563.1.4708 WP_000027563.1.47124 WP_000027563.1.47140 WP_000027563.1.47156 WP_000027563.1.47167 WP_000027563.1.47171 WP_000027563.1.47189 WP_000027563.1.47197 WP_000027563.1.4723 WP_000027563.1.47235 WP_000027563.1.47247 WP_000027563.1.4725 WP_000027563.1.47280 WP_000027563.1.47307 WP_000027563.1.47319 WP_000027563.1.47332 WP_000027563.1.47349 WP_000027563.1.47356 WP_000027563.1.47366 WP_000027563.1.47370 WP_000027563.1.4740 WP_000027563.1.47401 WP_000027563.1.47411 WP_000027563.1.4743 WP_000027563.1.47454 WP_000027563.1.47473 WP_000027563.1.47488 WP_000027563.1.47498 WP_000027563.1.47500 WP_000027563.1.47529 WP_000027563.1.47599 WP_000027563.1.47654 WP_000027563.1.47662 WP_000027563.1.47709 WP_000027563.1.47784 WP_000027563.1.47820 WP_000027563.1.47827 WP_000027563.1.4783 WP_000027563.1.47848 WP_000027563.1.4785 WP_000027563.1.47884 WP_000027563.1.47935 WP_000027563.1.47954 WP_000027563.1.47994 WP_000027563.1.48051 WP_000027563.1.48065 WP_000027563.1.48077 WP_000027563.1.48090 WP_000027563.1.4812 WP_000027563.1.48121 WP_000027563.1.48144 WP_000027563.1.48176 WP_000027563.1.48200 WP_000027563.1.48226 WP_000027563.1.48258 WP_000027563.1.4826 WP_000027563.1.48265 WP_000027563.1.48291 WP_000027563.1.48317 WP_000027563.1.48355 WP_000027563.1.48431 WP_000027563.1.48433 WP_000027563.1.48469 WP_000027563.1.4857 WP_000027563.1.48571 WP_000027563.1.48620 WP_000027563.1.48626 WP_000027563.1.48629 WP_000027563.1.48689 WP_000027563.1.48697 WP_000027563.1.48712 WP_000027563.1.48771 WP_000027563.1.48792 WP_000027563.1.48801 WP_000027563.1.48806 WP_000027563.1.48827 WP_000027563.1.48901 WP_000027563.1.48902 WP_000027563.1.48910 WP_000027563.1.4892 WP_000027563.1.48928 WP_000027563.1.48954 WP_000027563.1.49001 WP_000027563.1.49061 WP_000027563.1.49107 WP_000027563.1.49124 WP_000027563.1.49147 WP_000027563.1.49170 WP_000027563.1.49179 WP_000027563.1.49190 WP_000027563.1.49229 WP_000027563.1.49243 WP_000027563.1.49275 WP_000027563.1.4931 WP_000027563.1.49312 WP_000027563.1.49321 WP_000027563.1.49332 WP_000027563.1.49336 WP_000027563.1.49338 WP_000027563.1.49342 WP_000027563.1.49347 WP_000027563.1.49401 WP_000027563.1.49412 WP_000027563.1.49446 WP_000027563.1.49459 WP_000027563.1.49464 WP_000027563.1.49483 WP_000027563.1.49496 WP_000027563.1.49521 WP_000027563.1.49522 WP_000027563.1.49567 WP_000027563.1.49594 WP_000027563.1.49599 WP_000027563.1.49615 WP_000027563.1.49625 WP_000027563.1.49655 WP_000027563.1.49662 WP_000027563.1.49675 WP_000027563.1.49712 WP_000027563.1.49722 WP_000027563.1.49747 WP_000027563.1.49771 WP_000027563.1.49774 WP_000027563.1.49783 WP_000027563.1.49794 WP_000027563.1.49820 WP_000027563.1.4985 WP_000027563.1.49856 WP_000027563.1.49879 WP_000027563.1.49884 WP_000027563.1.49941 WP_000027563.1.49950 WP_000027563.1.49954 WP_000027563.1.49972 WP_000027563.1.49987 WP_000027563.1.5003 WP_000027563.1.50056 WP_000027563.1.50058 WP_000027563.1.50110 WP_000027563.1.50119 WP_000027563.1.50146 WP_000027563.1.5017 WP_000027563.1.50182 WP_000027563.1.50214 WP_000027563.1.50228 WP_000027563.1.50258 WP_000027563.1.50269 WP_000027563.1.50278 WP_000027563.1.50304 WP_000027563.1.50345 WP_000027563.1.50358 WP_000027563.1.50361 WP_000027563.1.50366 WP_000027563.1.5037 WP_000027563.1.50380 WP_000027563.1.50418 WP_000027563.1.50549 WP_000027563.1.50585 WP_000027563.1.50586 WP_000027563.1.50608 WP_000027563.1.50627 WP_000027563.1.5064 WP_000027563.1.5067 WP_000027563.1.50690 WP_000027563.1.50700 WP_000027563.1.50715 WP_000027563.1.50762 WP_000027563.1.50887 WP_000027563.1.50925 WP_000027563.1.50939 WP_000027563.1.50986 WP_000027563.1.50988 WP_000027563.1.50990 WP_000027563.1.50996 WP_000027563.1.51027 WP_000027563.1.511 WP_000027563.1.51154 WP_000027563.1.51170 WP_000027563.1.51171 WP_000027563.1.51175 WP_000027563.1.51180 WP_000027563.1.51190 WP_000027563.1.51203 WP_000027563.1.51211 WP_000027563.1.5124 WP_000027563.1.51248 WP_000027563.1.51253 WP_000027563.1.51260 WP_000027563.1.51278 WP_000027563.1.51299 WP_000027563.1.51323 WP_000027563.1.51360 WP_000027563.1.51392 WP_000027563.1.51426 WP_000027563.1.51462 WP_000027563.1.51505 WP_000027563.1.51525 WP_000027563.1.5153 WP_000027563.1.51537 WP_000027563.1.51587 WP_000027563.1.51596 WP_000027563.1.51643 WP_000027563.1.51693 WP_000027563.1.51707 WP_000027563.1.51718 WP_000027563.1.5172 WP_000027563.1.51757 WP_000027563.1.518 WP_000027563.1.51804 WP_000027563.1.51834 WP_000027563.1.51837 WP_000027563.1.51896 WP_000027563.1.51899 WP_000027563.1.51944 WP_000027563.1.5199 WP_000027563.1.52039 WP_000027563.1.52048 WP_000027563.1.52085 WP_000027563.1.52098 WP_000027563.1.5217 WP_000027563.1.52171 WP_000027563.1.52211 WP_000027563.1.52213 WP_000027563.1.52257 WP_000027563.1.52258 WP_000027563.1.52271 WP_000027563.1.52272 WP_000027563.1.52299 WP_000027563.1.52313 WP_000027563.1.52333 WP_000027563.1.52363 WP_000027563.1.52378 WP_000027563.1.5239 WP_000027563.1.52496 WP_000027563.1.52542 WP_000027563.1.52543 WP_000027563.1.52631 WP_000027563.1.5265 WP_000027563.1.52691 WP_000027563.1.52735 WP_000027563.1.52762 WP_000027563.1.52777 WP_000027563.1.52780 WP_000027563.1.5285 WP_000027563.1.52883 WP_000027563.1.52908 WP_000027563.1.52913 WP_000027563.1.52933 WP_000027563.1.52945 WP_000027563.1.52995 WP_000027563.1.53021 WP_000027563.1.53065 WP_000027563.1.53084 WP_000027563.1.5310 WP_000027563.1.53123 WP_000027563.1.53162 WP_000027563.1.53181 WP_000027563.1.532 WP_000027563.1.53211 WP_000027563.1.53223 WP_000027563.1.53242 WP_000027563.1.53251 WP_000027563.1.53252 WP_000027563.1.53262 WP_000027563.1.53270 WP_000027563.1.53327 WP_000027563.1.53356 WP_000027563.1.53360 WP_000027563.1.53401 WP_000027563.1.53410 WP_000027563.1.53415 WP_000027563.1.5342 WP_000027563.1.53428 WP_000027563.1.53537 WP_000027563.1.53557 WP_000027563.1.53587 WP_000027563.1.53589 WP_000027563.1.53594 WP_000027563.1.53649 WP_000027563.1.53687 WP_000027563.1.53690 WP_000027563.1.53706 WP_000027563.1.53810 WP_000027563.1.53866 WP_000027563.1.53884 WP_000027563.1.5391 WP_000027563.1.5393 WP_000027563.1.53931 WP_000027563.1.53940 WP_000027563.1.53966 WP_000027563.1.53978 WP_000027563.1.54023 WP_000027563.1.54024 WP_000027563.1.54051 WP_000027563.1.54091 WP_000027563.1.54095 WP_000027563.1.54102 WP_000027563.1.54104 WP_000027563.1.54188 WP_000027563.1.54202 WP_000027563.1.54208 WP_000027563.1.54213 WP_000027563.1.54307 WP_000027563.1.54313 WP_000027563.1.54329 WP_000027563.1.5434 WP_000027563.1.54388 WP_000027563.1.54394 WP_000027563.1.5441 WP_000027563.1.54411 WP_000027563.1.54418 WP_000027563.1.54439 WP_000027563.1.54454 WP_000027563.1.54463 WP_000027563.1.54524 WP_000027563.1.54534 WP_000027563.1.54546 WP_000027563.1.54590 WP_000027563.1.54591 WP_000027563.1.54601 WP_000027563.1.54643 WP_000027563.1.5467 WP_000027563.1.54754 WP_000027563.1.54760 WP_000027563.1.5478 WP_000027563.1.5479 WP_000027563.1.54798 WP_000027563.1.54829 WP_000027563.1.5486 WP_000027563.1.54875 WP_000027563.1.54883 WP_000027563.1.54918 WP_000027563.1.54927 WP_000027563.1.54940 WP_000027563.1.54991 WP_000027563.1.55005 WP_000027563.1.55112 WP_000027563.1.55115 WP_000027563.1.55134 WP_000027563.1.55149 WP_000027563.1.55179 WP_000027563.1.5520 WP_000027563.1.55218 WP_000027563.1.55222 WP_000027563.1.55273 WP_000027563.1.55275 WP_000027563.1.55286 WP_000027563.1.55338 WP_000027563.1.55357 WP_000027563.1.55417 WP_000027563.1.55420 WP_000027563.1.55425 WP_000027563.1.5546 WP_000027563.1.55492 WP_000027563.1.55550 WP_000027563.1.55597 WP_000027563.1.5561 WP_000027563.1.5570 WP_000027563.1.55709 WP_000027563.1.55720 WP_000027563.1.55730 WP_000027563.1.55731 WP_000027563.1.55744 WP_000027563.1.55787 WP_000027563.1.55790 WP_000027563.1.55808 WP_000027563.1.55820 WP_000027563.1.55838 WP_000027563.1.55844 WP_000027563.1.55888 WP_000027563.1.55892 WP_000027563.1.55896 WP_000027563.1.55897 WP_000027563.1.55936 WP_000027563.1.55981 WP_000027563.1.55988 WP_000027563.1.55990 WP_000027563.1.56033 WP_000027563.1.56040 WP_000027563.1.56047 WP_000027563.1.56072 WP_000027563.1.56122 WP_000027563.1.56139 WP_000027563.1.56142 WP_000027563.1.56149 WP_000027563.1.56151 WP_000027563.1.56177 WP_000027563.1.56193 WP_000027563.1.56278 WP_000027563.1.56293 WP_000027563.1.56302 WP_000027563.1.5632 WP_000027563.1.56338 WP_000027563.1.56371 WP_000027563.1.5639 WP_000027563.1.56390 WP_000027563.1.56392 WP_000027563.1.56402 WP_000027563.1.56457 WP_000027563.1.5646 WP_000027563.1.56469 WP_000027563.1.56481 WP_000027563.1.56489 WP_000027563.1.56491 WP_000027563.1.56523 WP_000027563.1.56543 WP_000027563.1.56554 WP_000027563.1.56571 WP_000027563.1.56650 WP_000027563.1.56662 WP_000027563.1.56680 WP_000027563.1.56689 WP_000027563.1.5670 WP_000027563.1.56786 WP_000027563.1.56821 WP_000027563.1.56835 WP_000027563.1.5685 WP_000027563.1.56933 WP_000027563.1.56936 WP_000027563.1.56941 WP_000027563.1.57011 WP_000027563.1.57032 WP_000027563.1.57045 WP_000027563.1.57068 WP_000027563.1.57071 WP_000027563.1.57079 WP_000027563.1.57100 WP_000027563.1.57159 WP_000027563.1.57180 WP_000027563.1.57182 WP_000027563.1.57185 WP_000027563.1.57197 WP_000027563.1.57213 WP_000027563.1.57222 WP_000027563.1.57278 WP_000027563.1.57280 WP_000027563.1.5742 WP_000027563.1.57438 WP_000027563.1.57451 WP_000027563.1.57453 WP_000027563.1.57466 WP_000027563.1.57487 WP_000027563.1.57517 WP_000027563.1.57538 WP_000027563.1.57539 WP_000027563.1.5755 WP_000027563.1.57608 WP_000027563.1.57610 WP_000027563.1.5764 WP_000027563.1.57646 WP_000027563.1.57659 WP_000027563.1.57812 WP_000027563.1.57832 WP_000027563.1.57836 WP_000027563.1.57854 WP_000027563.1.5787 WP_000027563.1.57983 WP_000027563.1.57994 WP_000027563.1.58009 WP_000027563.1.58022 WP_000027563.1.58048 WP_000027563.1.58057 WP_000027563.1.58060 WP_000027563.1.58092 WP_000027563.1.58094 WP_000027563.1.58097 WP_000027563.1.58098 WP_000027563.1.58107 WP_000027563.1.58146 WP_000027563.1.58163 WP_000027563.1.58169 WP_000027563.1.58172 WP_000027563.1.58206 WP_000027563.1.58233 WP_000027563.1.58238 WP_000027563.1.58248 WP_000027563.1.58267 WP_000027563.1.58292 WP_000027563.1.58340 WP_000027563.1.58345 WP_000027563.1.58384 WP_000027563.1.584 WP_000027563.1.58414 WP_000027563.1.58423 WP_000027563.1.58424 WP_000027563.1.58444 WP_000027563.1.58449 WP_000027563.1.58459 WP_000027563.1.58493 WP_000027563.1.585 WP_000027563.1.58507 WP_000027563.1.58514 WP_000027563.1.5852 WP_000027563.1.58552 WP_000027563.1.58560 WP_000027563.1.58572 WP_000027563.1.58582 WP_000027563.1.58609 WP_000027563.1.58617 WP_000027563.1.58657 WP_000027563.1.58707 WP_000027563.1.58723 WP_000027563.1.58737 WP_000027563.1.58799 WP_000027563.1.58837 WP_000027563.1.58977 WP_000027563.1.58983 WP_000027563.1.58999 WP_000027563.1.59026 WP_000027563.1.59038 WP_000027563.1.59047 WP_000027563.1.59055 WP_000027563.1.5906 WP_000027563.1.59060 WP_000027563.1.59073 WP_000027563.1.59083 WP_000027563.1.59119 WP_000027563.1.59190 WP_000027563.1.59263 WP_000027563.1.5927 WP_000027563.1.59280 WP_000027563.1.59291 WP_000027563.1.59292 WP_000027563.1.59293 WP_000027563.1.59359 WP_000027563.1.59374 WP_000027563.1.5942 WP_000027563.1.59425 WP_000027563.1.59426 WP_000027563.1.59434 WP_000027563.1.59470 WP_000027563.1.59483 WP_000027563.1.59491 WP_000027563.1.59572 WP_000027563.1.59579 WP_000027563.1.59613 WP_000027563.1.59660 WP_000027563.1.59679 WP_000027563.1.59714 WP_000027563.1.59717 WP_000027563.1.59733 WP_000027563.1.59737 WP_000027563.1.59745 WP_000027563.1.59748 WP_000027563.1.59782 WP_000027563.1.59791 WP_000027563.1.59793 WP_000027563.1.59815 WP_000027563.1.59838 WP_000027563.1.59858 WP_000027563.1.59894 WP_000027563.1.59900 WP_000027563.1.59905 WP_000027563.1.59931 WP_000027563.1.59932 WP_000027563.1.59959 WP_000027563.1.59970 WP_000027563.1.59981 WP_000027563.1.59998 WP_000027563.1.60023 WP_000027563.1.60031 WP_000027563.1.60042 WP_000027563.1.60043 WP_000027563.1.60048 WP_000027563.1.60070 WP_000027563.1.60096 WP_000027563.1.60117 WP_000027563.1.6013 WP_000027563.1.60133 WP_000027563.1.6022 WP_000027563.1.60235 WP_000027563.1.60304 WP_000027563.1.60325 WP_000027563.1.60350 WP_000027563.1.60373 WP_000027563.1.60374 WP_000027563.1.60387 WP_000027563.1.60457 WP_000027563.1.60461 WP_000027563.1.60491 WP_000027563.1.60544 WP_000027563.1.60555 WP_000027563.1.6059 WP_000027563.1.60591 WP_000027563.1.60606 WP_000027563.1.6061 WP_000027563.1.60613 WP_000027563.1.60630 WP_000027563.1.6064 WP_000027563.1.60647 WP_000027563.1.60654 WP_000027563.1.6068 WP_000027563.1.60732 WP_000027563.1.60744 WP_000027563.1.60761 WP_000027563.1.60832 WP_000027563.1.60835 WP_000027563.1.60872 WP_000027563.1.60935 WP_000027563.1.61005 WP_000027563.1.61006 WP_000027563.1.61039 WP_000027563.1.61046 WP_000027563.1.61058 WP_000027563.1.61097 WP_000027563.1.61099 WP_000027563.1.6110 WP_000027563.1.61102 WP_000027563.1.61108 WP_000027563.1.61112 WP_000027563.1.61121 WP_000027563.1.61132 WP_000027563.1.61186 WP_000027563.1.61225 WP_000027563.1.61245 WP_000027563.1.61253 WP_000027563.1.61292 WP_000027563.1.613 WP_000027563.1.61360 WP_000027563.1.61364 WP_000027563.1.61442 WP_000027563.1.61445 WP_000027563.1.61480 WP_000027563.1.615 WP_000027563.1.61512 WP_000027563.1.61617 WP_000027563.1.61623 WP_000027563.1.61636 WP_000027563.1.61739 WP_000027563.1.61758 WP_000027563.1.61772 WP_000027563.1.61789 WP_000027563.1.618 WP_000027563.1.61806 WP_000027563.1.61835 WP_000027563.1.61874 WP_000027563.1.61926 WP_000027563.1.61948 WP_000027563.1.61957 WP_000027563.1.61985 WP_000027563.1.62038 WP_000027563.1.62041 WP_000027563.1.62043 WP_000027563.1.62091 WP_000027563.1.62102 WP_000027563.1.62135 WP_000027563.1.62157 WP_000027563.1.62182 WP_000027563.1.62207 WP_000027563.1.62236 WP_000027563.1.62262 WP_000027563.1.62290 WP_000027563.1.62358 WP_000027563.1.62424 WP_000027563.1.62447 WP_000027563.1.62454 WP_000027563.1.62480 WP_000027563.1.62503 WP_000027563.1.62514 WP_000027563.1.62529 WP_000027563.1.62555 WP_000027563.1.62586 WP_000027563.1.6261 WP_000027563.1.62631 WP_000027563.1.62675 WP_000027563.1.62681 WP_000027563.1.62762 WP_000027563.1.62769 WP_000027563.1.62780 WP_000027563.1.62784 WP_000027563.1.62787 WP_000027563.1.62788 WP_000027563.1.62819 WP_000027563.1.6282 WP_000027563.1.62843 WP_000027563.1.62850 WP_000027563.1.62851 WP_000027563.1.62866 WP_000027563.1.62885 WP_000027563.1.62888 WP_000027563.1.62931 WP_000027563.1.62951 WP_000027563.1.6299 WP_000027563.1.6307 WP_000027563.1.63078 WP_000027563.1.63177 WP_000027563.1.63246 WP_000027563.1.63271 WP_000027563.1.63285 WP_000027563.1.63305 WP_000027563.1.6331 WP_000027563.1.63310 WP_000027563.1.63370 WP_000027563.1.63419 WP_000027563.1.63433 WP_000027563.1.63437 WP_000027563.1.63445 WP_000027563.1.63465 WP_000027563.1.63466 WP_000027563.1.63467 WP_000027563.1.63478 WP_000027563.1.63491 WP_000027563.1.63556 WP_000027563.1.63563 WP_000027563.1.63576 WP_000027563.1.63586 WP_000027563.1.63604 WP_000027563.1.63608 WP_000027563.1.63615 WP_000027563.1.6364 WP_000027563.1.63810 WP_000027563.1.63814 WP_000027563.1.63821 WP_000027563.1.63872 WP_000027563.1.63944 WP_000027563.1.63957 WP_000027563.1.63969 WP_000027563.1.64014 WP_000027563.1.64030 WP_000027563.1.64050 WP_000027563.1.64053 WP_000027563.1.64074 WP_000027563.1.64086 WP_000027563.1.6416 WP_000027563.1.64161 WP_000027563.1.64175 WP_000027563.1.64180 WP_000027563.1.64190 WP_000027563.1.64286 WP_000027563.1.643 WP_000027563.1.64312 WP_000027563.1.64356 WP_000027563.1.64371 WP_000027563.1.64380 WP_000027563.1.64391 WP_000027563.1.6441 WP_000027563.1.64417 WP_000027563.1.64438 WP_000027563.1.6444 WP_000027563.1.6445 WP_000027563.1.64458 WP_000027563.1.6446 WP_000027563.1.64519 WP_000027563.1.64520 WP_000027563.1.64547 WP_000027563.1.64621 WP_000027563.1.64657 WP_000027563.1.64670 WP_000027563.1.64693 WP_000027563.1.647 WP_000027563.1.64712 WP_000027563.1.64749 WP_000027563.1.64875 WP_000027563.1.64881 WP_000027563.1.64901 WP_000027563.1.64946 WP_000027563.1.64970 WP_000027563.1.64990 WP_000027563.1.6500 WP_000027563.1.65023 WP_000027563.1.65035 WP_000027563.1.65040 WP_000027563.1.65084 WP_000027563.1.65097 WP_000027563.1.65104 WP_000027563.1.6511 WP_000027563.1.65114 WP_000027563.1.65116 WP_000027563.1.65118 WP_000027563.1.65122 WP_000027563.1.65151 WP_000027563.1.65179 WP_000027563.1.65194 WP_000027563.1.65240 WP_000027563.1.6527 WP_000027563.1.65286 WP_000027563.1.65355 WP_000027563.1.65370 WP_000027563.1.65372 WP_000027563.1.654 WP_000027563.1.65405 WP_000027563.1.65408 WP_000027563.1.65413 WP_000027563.1.65456 WP_000027563.1.65493 WP_000027563.1.65531 WP_000027563.1.65546 WP_000027563.1.65565 WP_000027563.1.65571 WP_000027563.1.65606 WP_000027563.1.6563 WP_000027563.1.65662 WP_000027563.1.6576 WP_000027563.1.65762 WP_000027563.1.65834 WP_000027563.1.6587 WP_000027563.1.65875 WP_000027563.1.65898 WP_000027563.1.65957 WP_000027563.1.65962 WP_000027563.1.65963 WP_000027563.1.65976 WP_000027563.1.65978 WP_000027563.1.65988 WP_000027563.1.6599 WP_000027563.1.65991 WP_000027563.1.66007 WP_000027563.1.66016 WP_000027563.1.66017 WP_000027563.1.66033 WP_000027563.1.66044 WP_000027563.1.66071 WP_000027563.1.6609 WP_000027563.1.66094 WP_000027563.1.66100 WP_000027563.1.66121 WP_000027563.1.6618 WP_000027563.1.66181 WP_000027563.1.66255 WP_000027563.1.66288 WP_000027563.1.66290 WP_000027563.1.66295 WP_000027563.1.66376 WP_000027563.1.66392 WP_000027563.1.66421 WP_000027563.1.66448 WP_000027563.1.66511 WP_000027563.1.66523 WP_000027563.1.66531 WP_000027563.1.6654 WP_000027563.1.66566 WP_000027563.1.66579 WP_000027563.1.6666 WP_000027563.1.66668 WP_000027563.1.66706 WP_000027563.1.66708 WP_000027563.1.66727 WP_000027563.1.66758 WP_000027563.1.66783 WP_000027563.1.66787 WP_000027563.1.66794 WP_000027563.1.66796 WP_000027563.1.66849 WP_000027563.1.66873 WP_000027563.1.66922 WP_000027563.1.66926 WP_000027563.1.6698 WP_000027563.1.66984 WP_000027563.1.67018 WP_000027563.1.67026 WP_000027563.1.67029 WP_000027563.1.67035 WP_000027563.1.67047 WP_000027563.1.67055 WP_000027563.1.6706 WP_000027563.1.67073 WP_000027563.1.67102 WP_000027563.1.67132 WP_000027563.1.67136 WP_000027563.1.67150 WP_000027563.1.67153 WP_000027563.1.67158 WP_000027563.1.67164 WP_000027563.1.67174 WP_000027563.1.67194 WP_000027563.1.67214 WP_000027563.1.6723 WP_000027563.1.67258 WP_000027563.1.67284 WP_000027563.1.67293 WP_000027563.1.67373 WP_000027563.1.67383 WP_000027563.1.67427 WP_000027563.1.67446 WP_000027563.1.67451 WP_000027563.1.67452 WP_000027563.1.67464 WP_000027563.1.67495 WP_000027563.1.67533 WP_000027563.1.67590 WP_000027563.1.67606 WP_000027563.1.67663 WP_000027563.1.67669 WP_000027563.1.67676 WP_000027563.1.6769 WP_000027563.1.67690 WP_000027563.1.67726 WP_000027563.1.67732 WP_000027563.1.67737 WP_000027563.1.67753 WP_000027563.1.67760 WP_000027563.1.67775 WP_000027563.1.67780 WP_000027563.1.678 WP_000027563.1.67841 WP_000027563.1.67861 WP_000027563.1.67891 WP_000027563.1.67894 WP_000027563.1.6793 WP_000027563.1.67999 WP_000027563.1.68011 WP_000027563.1.68012 WP_000027563.1.6802 WP_000027563.1.68039 WP_000027563.1.68052 WP_000027563.1.68058 WP_000027563.1.68059 WP_000027563.1.68063 WP_000027563.1.68070 WP_000027563.1.68096 WP_000027563.1.68138 WP_000027563.1.68157 WP_000027563.1.68177 WP_000027563.1.682 WP_000027563.1.68200 WP_000027563.1.68231 WP_000027563.1.68278 WP_000027563.1.68279 WP_000027563.1.68292 WP_000027563.1.68300 WP_000027563.1.68347 WP_000027563.1.68362 WP_000027563.1.68372 WP_000027563.1.68411 WP_000027563.1.68441 WP_000027563.1.68442 WP_000027563.1.68493 WP_000027563.1.68523 WP_000027563.1.68524 WP_000027563.1.68572 WP_000027563.1.6859 WP_000027563.1.6860 WP_000027563.1.68609 WP_000027563.1.68632 WP_000027563.1.68695 WP_000027563.1.68701 WP_000027563.1.68735 WP_000027563.1.68751 WP_000027563.1.68793 WP_000027563.1.68795 WP_000027563.1.6880 WP_000027563.1.68801 WP_000027563.1.68838 WP_000027563.1.68847 WP_000027563.1.68865 WP_000027563.1.6887 WP_000027563.1.68873 WP_000027563.1.68877 WP_000027563.1.68911 WP_000027563.1.68924 WP_000027563.1.68936 WP_000027563.1.68942 WP_000027563.1.68952 WP_000027563.1.68956 WP_000027563.1.68995 WP_000027563.1.69054 WP_000027563.1.69127 WP_000027563.1.69160 WP_000027563.1.6921 WP_000027563.1.69221 WP_000027563.1.69303 WP_000027563.1.69350 WP_000027563.1.69351 WP_000027563.1.69382 WP_000027563.1.694 WP_000027563.1.69438 WP_000027563.1.69450 WP_000027563.1.69502 WP_000027563.1.69506 WP_000027563.1.69589 WP_000027563.1.69643 WP_000027563.1.697 WP_000027563.1.69716 WP_000027563.1.69735 WP_000027563.1.69780 WP_000027563.1.69786 WP_000027563.1.69810 WP_000027563.1.69818 WP_000027563.1.69831 WP_000027563.1.69832 WP_000027563.1.69887 WP_000027563.1.69896 WP_000027563.1.69963 WP_000027563.1.69972 WP_000027563.1.69999 WP_000027563.1.7001 WP_000027563.1.70041 WP_000027563.1.70063 WP_000027563.1.701 WP_000027563.1.70123 WP_000027563.1.70125 WP_000027563.1.7015 WP_000027563.1.70200 WP_000027563.1.70213 WP_000027563.1.70230 WP_000027563.1.70300 WP_000027563.1.70337 WP_000027563.1.70386 WP_000027563.1.70408 WP_000027563.1.70477 WP_000027563.1.7050 WP_000027563.1.70517 WP_000027563.1.7052 WP_000027563.1.70539 WP_000027563.1.70563 WP_000027563.1.70576 WP_000027563.1.70592 WP_000027563.1.70597 WP_000027563.1.70628 WP_000027563.1.70655 WP_000027563.1.70686 WP_000027563.1.70705 WP_000027563.1.70713 WP_000027563.1.70723 WP_000027563.1.70748 WP_000027563.1.70787 WP_000027563.1.70801 WP_000027563.1.70803 WP_000027563.1.70952 WP_000027563.1.70967 WP_000027563.1.71003 WP_000027563.1.71042 WP_000027563.1.71099 WP_000027563.1.71113 WP_000027563.1.71134 WP_000027563.1.71139 WP_000027563.1.71205 WP_000027563.1.7121 WP_000027563.1.71221 WP_000027563.1.71225 WP_000027563.1.71226 WP_000027563.1.71269 WP_000027563.1.71272 WP_000027563.1.71275 WP_000027563.1.71287 WP_000027563.1.71294 WP_000027563.1.71311 WP_000027563.1.71354 WP_000027563.1.71403 WP_000027563.1.71405 WP_000027563.1.71421 WP_000027563.1.71423 WP_000027563.1.71448 WP_000027563.1.71537 WP_000027563.1.71538 WP_000027563.1.71562 WP_000027563.1.71563 WP_000027563.1.71607 WP_000027563.1.71695 WP_000027563.1.71712 WP_000027563.1.71732 WP_000027563.1.71757 WP_000027563.1.71830 WP_000027563.1.71840 WP_000027563.1.71855 WP_000027563.1.71856 WP_000027563.1.71874 WP_000027563.1.7192 WP_000027563.1.71939 WP_000027563.1.71940 WP_000027563.1.71967 WP_000027563.1.71972 WP_000027563.1.71987 WP_000027563.1.72013 WP_000027563.1.72016 WP_000027563.1.72021 WP_000027563.1.72028 WP_000027563.1.72033 WP_000027563.1.72048 WP_000027563.1.72066 WP_000027563.1.72090 WP_000027563.1.72098 WP_000027563.1.72117 WP_000027563.1.72153 WP_000027563.1.72161 WP_000027563.1.72180 WP_000027563.1.72208 WP_000027563.1.72212 WP_000027563.1.72248 WP_000027563.1.72258 WP_000027563.1.72270 WP_000027563.1.72279 WP_000027563.1.72290 WP_000027563.1.72298 WP_000027563.1.723 WP_000027563.1.72322 WP_000027563.1.72359 WP_000027563.1.72388 WP_000027563.1.72425 WP_000027563.1.72427 WP_000027563.1.72436 WP_000027563.1.72469 WP_000027563.1.72493 WP_000027563.1.72507 WP_000027563.1.72521 WP_000027563.1.72551 WP_000027563.1.72588 WP_000027563.1.72596 WP_000027563.1.72599 WP_000027563.1.72608 WP_000027563.1.72614 WP_000027563.1.72641 WP_000027563.1.72694 WP_000027563.1.72695 WP_000027563.1.72698 WP_000027563.1.72700 WP_000027563.1.72706 WP_000027563.1.72725 WP_000027563.1.72729 WP_000027563.1.72758 WP_000027563.1.72764 WP_000027563.1.7277 WP_000027563.1.7281 WP_000027563.1.72858 WP_000027563.1.72893 WP_000027563.1.7291 WP_000027563.1.72913 WP_000027563.1.72950 WP_000027563.1.72962 WP_000027563.1.73032 WP_000027563.1.73061 WP_000027563.1.73075 WP_000027563.1.7309 WP_000027563.1.73126 WP_000027563.1.73197 WP_000027563.1.73215 WP_000027563.1.73217 WP_000027563.1.73230 WP_000027563.1.73277 WP_000027563.1.73283 WP_000027563.1.73291 WP_000027563.1.73326 WP_000027563.1.73333 WP_000027563.1.73343 WP_000027563.1.73344 WP_000027563.1.73349 WP_000027563.1.7345 WP_000027563.1.73486 WP_000027563.1.7349 WP_000027563.1.73572 WP_000027563.1.73626 WP_000027563.1.73663 WP_000027563.1.73700 WP_000027563.1.73709 WP_000027563.1.73743 WP_000027563.1.73748 WP_000027563.1.73783 WP_000027563.1.73785 WP_000027563.1.73797 WP_000027563.1.73801 WP_000027563.1.73807 WP_000027563.1.73843 WP_000027563.1.73897 WP_000027563.1.73908 WP_000027563.1.7392 WP_000027563.1.73934 WP_000027563.1.73968 WP_000027563.1.73995 WP_000027563.1.73996 WP_000027563.1.74032 WP_000027563.1.74041 WP_000027563.1.74045 WP_000027563.1.74051 WP_000027563.1.7407 WP_000027563.1.7413 WP_000027563.1.74185 WP_000027563.1.74251 WP_000027563.1.74267 WP_000027563.1.7429 WP_000027563.1.74358 WP_000027563.1.74367 WP_000027563.1.744 WP_000027563.1.74426 WP_000027563.1.74431 WP_000027563.1.7446 WP_000027563.1.74513 WP_000027563.1.74520 WP_000027563.1.74521 WP_000027563.1.74536 WP_000027563.1.74557 WP_000027563.1.74611 WP_000027563.1.74623 WP_000027563.1.74624 WP_000027563.1.74652 WP_000027563.1.74670 WP_000027563.1.74687 WP_000027563.1.74705 WP_000027563.1.74720 WP_000027563.1.74735 WP_000027563.1.74752 WP_000027563.1.74765 WP_000027563.1.74767 WP_000027563.1.7478 WP_000027563.1.74811 WP_000027563.1.74828 WP_000027563.1.74844 WP_000027563.1.74880 WP_000027563.1.74885 WP_000027563.1.74895 WP_000027563.1.74904 WP_000027563.1.74915 WP_000027563.1.75021 WP_000027563.1.75029 WP_000027563.1.75030 WP_000027563.1.75050 WP_000027563.1.75087 WP_000027563.1.75100 WP_000027563.1.75118 WP_000027563.1.75136 WP_000027563.1.75145 WP_000027563.1.75149 WP_000027563.1.75164 WP_000027563.1.75218 WP_000027563.1.75228 WP_000027563.1.75248 WP_000027563.1.75270 WP_000027563.1.75306 WP_000027563.1.7536 WP_000027563.1.75360 WP_000027563.1.75382 WP_000027563.1.7539 WP_000027563.1.75419 WP_000027563.1.75435 WP_000027563.1.75465 WP_000027563.1.75507 WP_000027563.1.75515 WP_000027563.1.75536 WP_000027563.1.75557 WP_000027563.1.75577 WP_000027563.1.75588 WP_000027563.1.75676 WP_000027563.1.75687 WP_000027563.1.75694 WP_000027563.1.75696 WP_000027563.1.75725 WP_000027563.1.75767 WP_000027563.1.75786 WP_000027563.1.75808 WP_000027563.1.7583 WP_000027563.1.75892 WP_000027563.1.75918 WP_000027563.1.7597 WP_000027563.1.75973 WP_000027563.1.75989 WP_000027563.1.75999 WP_000027563.1.76019 WP_000027563.1.76030 WP_000027563.1.76054 WP_000027563.1.76057 WP_000027563.1.7608 WP_000027563.1.76087 WP_000027563.1.76129 WP_000027563.1.7613 WP_000027563.1.76152 WP_000027563.1.76189 WP_000027563.1.76194 WP_000027563.1.76237 WP_000027563.1.76268 WP_000027563.1.76269 WP_000027563.1.76335 WP_000027563.1.76361 WP_000027563.1.76384 WP_000027563.1.76390 WP_000027563.1.76407 WP_000027563.1.76448 WP_000027563.1.76469 WP_000027563.1.76477 WP_000027563.1.76504 WP_000027563.1.76542 WP_000027563.1.76596 WP_000027563.1.76643 WP_000027563.1.76656 WP_000027563.1.76660 WP_000027563.1.76697 WP_000027563.1.76751 WP_000027563.1.76759 WP_000027563.1.76827 WP_000027563.1.76831 WP_000027563.1.76863 WP_000027563.1.7689 WP_000027563.1.76909 WP_000027563.1.76961 WP_000027563.1.76966 WP_000027563.1.76994 WP_000027563.1.77007 WP_000027563.1.77022 WP_000027563.1.77036 WP_000027563.1.77057 WP_000027563.1.77070 WP_000027563.1.77081 WP_000027563.1.77099 WP_000027563.1.771 WP_000027563.1.77109 WP_000027563.1.77128 WP_000027563.1.77134 WP_000027563.1.77162 WP_000027563.1.77163 WP_000027563.1.77173 WP_000027563.1.77200 WP_000027563.1.77204 WP_000027563.1.77224 WP_000027563.1.77239 WP_000027563.1.77255 WP_000027563.1.77258 WP_000027563.1.77275 WP_000027563.1.7729 WP_000027563.1.77290 WP_000027563.1.77291 WP_000027563.1.77296 WP_000027563.1.7731 WP_000027563.1.77320 WP_000027563.1.77341 WP_000027563.1.77392 WP_000027563.1.77408 WP_000027563.1.77432 WP_000027563.1.77437 WP_000027563.1.77455 WP_000027563.1.77462 WP_000027563.1.7747 WP_000027563.1.77471 WP_000027563.1.77477 WP_000027563.1.77481 WP_000027563.1.7750 WP_000027563.1.77511 WP_000027563.1.77577 WP_000027563.1.77581 WP_000027563.1.77608 WP_000027563.1.77626 WP_000027563.1.77632 WP_000027563.1.77643 WP_000027563.1.77644 WP_000027563.1.77707 WP_000027563.1.7775 WP_000027563.1.77760 WP_000027563.1.77767 WP_000027563.1.7780 WP_000027563.1.77813 WP_000027563.1.77816 WP_000027563.1.77826 WP_000027563.1.77833 WP_000027563.1.77929 WP_000027563.1.77961 WP_000027563.1.77979 WP_000027563.1.7799 WP_000027563.1.78010 WP_000027563.1.78063 WP_000027563.1.7808 WP_000027563.1.78099 WP_000027563.1.78183 WP_000027563.1.78187 WP_000027563.1.78202 WP_000027563.1.78232 WP_000027563.1.78297 WP_000027563.1.78305 WP_000027563.1.78337 WP_000027563.1.78376 WP_000027563.1.784 WP_000027563.1.78445 WP_000027563.1.78463 WP_000027563.1.78477 WP_000027563.1.78491 WP_000027563.1.78512 WP_000027563.1.78515 WP_000027563.1.7855 WP_000027563.1.78575 WP_000027563.1.78581 WP_000027563.1.78586 WP_000027563.1.78593 WP_000027563.1.78610 WP_000027563.1.78611 WP_000027563.1.78622 WP_000027563.1.78677 WP_000027563.1.78689 WP_000027563.1.78698 WP_000027563.1.78714 WP_000027563.1.78757 WP_000027563.1.78773 WP_000027563.1.78775 WP_000027563.1.78814 WP_000027563.1.78843 WP_000027563.1.78845 WP_000027563.1.78891 WP_000027563.1.78893 WP_000027563.1.78895 WP_000027563.1.78919 WP_000027563.1.78955 WP_000027563.1.78956 WP_000027563.1.79001 WP_000027563.1.7901 WP_000027563.1.79065 WP_000027563.1.79067 WP_000027563.1.79075 WP_000027563.1.79100 WP_000027563.1.79126 WP_000027563.1.79172 WP_000027563.1.79233 WP_000027563.1.79243 WP_000027563.1.79276 WP_000027563.1.79342 WP_000027563.1.79346 WP_000027563.1.79348 WP_000027563.1.79365 WP_000027563.1.79368 WP_000027563.1.7937 WP_000027563.1.79389 WP_000027563.1.79391 WP_000027563.1.7940 WP_000027563.1.79409 WP_000027563.1.79443 WP_000027563.1.7952 WP_000027563.1.79525 WP_000027563.1.79526 WP_000027563.1.79528 WP_000027563.1.79563 WP_000027563.1.79576 WP_000027563.1.79606 WP_000027563.1.79619 WP_000027563.1.79640 WP_000027563.1.7967 WP_000027563.1.79707 WP_000027563.1.79713 WP_000027563.1.79715 WP_000027563.1.79749 WP_000027563.1.79759 WP_000027563.1.79800 WP_000027563.1.79824 WP_000027563.1.7985 WP_000027563.1.79866 WP_000027563.1.79905 WP_000027563.1.79932 WP_000027563.1.79933 WP_000027563.1.79936 WP_000027563.1.79955 WP_000027563.1.79965 WP_000027563.1.79973 WP_000027563.1.80 WP_000027563.1.80026 WP_000027563.1.80060 WP_000027563.1.80061 WP_000027563.1.80063 WP_000027563.1.8007 WP_000027563.1.80071 WP_000027563.1.80096 WP_000027563.1.80141 WP_000027563.1.80168 WP_000027563.1.80309 WP_000027563.1.80330 WP_000027563.1.80392 WP_000027563.1.804 WP_000027563.1.80402 WP_000027563.1.80558 WP_000027563.1.80559 WP_000027563.1.80578 WP_000027563.1.80606 WP_000027563.1.80626 WP_000027563.1.80660 WP_000027563.1.80662 WP_000027563.1.80666 WP_000027563.1.8068 WP_000027563.1.80709 WP_000027563.1.80718 WP_000027563.1.80789 WP_000027563.1.80862 WP_000027563.1.80945 WP_000027563.1.80946 WP_000027563.1.80948 WP_000027563.1.80983 WP_000027563.1.80985 WP_000027563.1.810 WP_000027563.1.81026 WP_000027563.1.81032 WP_000027563.1.81054 WP_000027563.1.81056 WP_000027563.1.81070 WP_000027563.1.81098 WP_000027563.1.81104 WP_000027563.1.81120 WP_000027563.1.81141 WP_000027563.1.81160 WP_000027563.1.81186 WP_000027563.1.81219 WP_000027563.1.81266 WP_000027563.1.81267 WP_000027563.1.81273 WP_000027563.1.81316 WP_000027563.1.81323 WP_000027563.1.81347 WP_000027563.1.81376 WP_000027563.1.81396 WP_000027563.1.814 WP_000027563.1.81418 WP_000027563.1.81420 WP_000027563.1.81423 WP_000027563.1.81442 WP_000027563.1.81469 WP_000027563.1.81514 WP_000027563.1.81517 WP_000027563.1.81580 WP_000027563.1.81588 WP_000027563.1.81596 WP_000027563.1.81618 WP_000027563.1.81625 WP_000027563.1.81723 WP_000027563.1.81754 WP_000027563.1.81761 WP_000027563.1.81821 WP_000027563.1.81843 WP_000027563.1.81869 WP_000027563.1.81873 WP_000027563.1.81914 WP_000027563.1.81934 WP_000027563.1.81972 WP_000027563.1.81975 WP_000027563.1.82 WP_000027563.1.82008 WP_000027563.1.82010 WP_000027563.1.82057 WP_000027563.1.82104 WP_000027563.1.82106 WP_000027563.1.82123 WP_000027563.1.82137 WP_000027563.1.82166 WP_000027563.1.82221 WP_000027563.1.82242 WP_000027563.1.82246 WP_000027563.1.82296 WP_000027563.1.82485 WP_000027563.1.82499 WP_000027563.1.82527 WP_000027563.1.82539 WP_000027563.1.8255 WP_000027563.1.82572 WP_000027563.1.82589 WP_000027563.1.82594 WP_000027563.1.82629 WP_000027563.1.82661 WP_000027563.1.8268 WP_000027563.1.82682 WP_000027563.1.82698 WP_000027563.1.82700 WP_000027563.1.82711 WP_000027563.1.82747 WP_000027563.1.82776 WP_000027563.1.82797 WP_000027563.1.82808 WP_000027563.1.82816 WP_000027563.1.82820 WP_000027563.1.82831 WP_000027563.1.82853 WP_000027563.1.82902 WP_000027563.1.82923 WP_000027563.1.83035 WP_000027563.1.83036 WP_000027563.1.83059 WP_000027563.1.83099 WP_000027563.1.83118 WP_000027563.1.83127 WP_000027563.1.83214 WP_000027563.1.83218 WP_000027563.1.83253 WP_000027563.1.83256 WP_000027563.1.83313 WP_000027563.1.83347 WP_000027563.1.83375 WP_000027563.1.83393 WP_000027563.1.83481 WP_000027563.1.83564 WP_000027563.1.83582 WP_000027563.1.83644 WP_000027563.1.83660 WP_000027563.1.83668 WP_000027563.1.83684 WP_000027563.1.83712 WP_000027563.1.83762 WP_000027563.1.8384 WP_000027563.1.8386 WP_000027563.1.83911 WP_000027563.1.83936 WP_000027563.1.84004 WP_000027563.1.84014 WP_000027563.1.84021 WP_000027563.1.8405 WP_000027563.1.84059 WP_000027563.1.8408 WP_000027563.1.84140 WP_000027563.1.84197 WP_000027563.1.84215 WP_000027563.1.84219 WP_000027563.1.84264 WP_000027563.1.84312 WP_000027563.1.84316 WP_000027563.1.84319 WP_000027563.1.84326 WP_000027563.1.84348 WP_000027563.1.84402 WP_000027563.1.84464 WP_000027563.1.8447 WP_000027563.1.84476 WP_000027563.1.84482 WP_000027563.1.84484 WP_000027563.1.84486 WP_000027563.1.84531 WP_000027563.1.84635 WP_000027563.1.84639 WP_000027563.1.84656 WP_000027563.1.84657 WP_000027563.1.8470 WP_000027563.1.84731 WP_000027563.1.8477 WP_000027563.1.84784 WP_000027563.1.84797 WP_000027563.1.84841 WP_000027563.1.84875 WP_000027563.1.84881 WP_000027563.1.84893 WP_000027563.1.84941 WP_000027563.1.84966 WP_000027563.1.84989 WP_000027563.1.85025 WP_000027563.1.85048 WP_000027563.1.85098 WP_000027563.1.85105 WP_000027563.1.85125 WP_000027563.1.85138 WP_000027563.1.85155 WP_000027563.1.85188 WP_000027563.1.85241 WP_000027563.1.85252 WP_000027563.1.85253 WP_000027563.1.85329 WP_000027563.1.85361 WP_000027563.1.85384 WP_000027563.1.85500 WP_000027563.1.85525 WP_000027563.1.85554 WP_000027563.1.85556 WP_000027563.1.85558 WP_000027563.1.85578 WP_000027563.1.85593 WP_000027563.1.85623 WP_000027563.1.85722 WP_000027563.1.85762 WP_000027563.1.85772 WP_000027563.1.85781 WP_000027563.1.85939 WP_000027563.1.85944 WP_000027563.1.86016 WP_000027563.1.86035 WP_000027563.1.86104 WP_000027563.1.86105 WP_000027563.1.86166 WP_000027563.1.86171 WP_000027563.1.86179 WP_000027563.1.86196 WP_000027563.1.86210 WP_000027563.1.86225 WP_000027563.1.86255 WP_000027563.1.86261 WP_000027563.1.86273 WP_000027563.1.86340 WP_000027563.1.86353 WP_000027563.1.86411 WP_000027563.1.86451 WP_000027563.1.86454 WP_000027563.1.8652 WP_000027563.1.8656 WP_000027563.1.86560 WP_000027563.1.86574 WP_000027563.1.86583 WP_000027563.1.86586 WP_000027563.1.86598 WP_000027563.1.86613 WP_000027563.1.86627 WP_000027563.1.86667 WP_000027563.1.86673 WP_000027563.1.86707 WP_000027563.1.86727 WP_000027563.1.86734 WP_000027563.1.86787 WP_000027563.1.86788 WP_000027563.1.86994 WP_000027563.1.87043 WP_000027563.1.8705 WP_000027563.1.87067 WP_000027563.1.87074 WP_000027563.1.87075 WP_000027563.1.87076 WP_000027563.1.87102 WP_000027563.1.87205 WP_000027563.1.87247 WP_000027563.1.87254 WP_000027563.1.87310 WP_000027563.1.87358 WP_000027563.1.87371 WP_000027563.1.87382 WP_000027563.1.87400 WP_000027563.1.87443 WP_000027563.1.87465 WP_000027563.1.87504 WP_000027563.1.87590 WP_000027563.1.87616 WP_000027563.1.87633 WP_000027563.1.87675 WP_000027563.1.87694 WP_000027563.1.87696 WP_000027563.1.87728 WP_000027563.1.87738 WP_000027563.1.87766 WP_000027563.1.8778 WP_000027563.1.87822 WP_000027563.1.87883 WP_000027563.1.87919 WP_000027563.1.87973 WP_000027563.1.87976 WP_000027563.1.87990 WP_000027563.1.88020 WP_000027563.1.8807 WP_000027563.1.88082 WP_000027563.1.88119 WP_000027563.1.88147 WP_000027563.1.88155 WP_000027563.1.88197 WP_000027563.1.8822 WP_000027563.1.88234 WP_000027563.1.88238 WP_000027563.1.88260 WP_000027563.1.88285 WP_000027563.1.88304 WP_000027563.1.88336 WP_000027563.1.88379 WP_000027563.1.88427 WP_000027563.1.8843 WP_000027563.1.88499 WP_000027563.1.88524 WP_000027563.1.88528 WP_000027563.1.88535 WP_000027563.1.8855 WP_000027563.1.88562 WP_000027563.1.88631 WP_000027563.1.88686 WP_000027563.1.88732 WP_000027563.1.88752 WP_000027563.1.88757 WP_000027563.1.88767 WP_000027563.1.88793 WP_000027563.1.88803 WP_000027563.1.88826 WP_000027563.1.88883 WP_000027563.1.88891 WP_000027563.1.88997 WP_000027563.1.89043 WP_000027563.1.89067 WP_000027563.1.89150 WP_000027563.1.89197 WP_000027563.1.89203 WP_000027563.1.89214 WP_000027563.1.89217 WP_000027563.1.89285 WP_000027563.1.89322 WP_000027563.1.89334 WP_000027563.1.89335 WP_000027563.1.89351 WP_000027563.1.89379 WP_000027563.1.89385 WP_000027563.1.89396 WP_000027563.1.89405 WP_000027563.1.89427 WP_000027563.1.89432 WP_000027563.1.8945 WP_000027563.1.89455 WP_000027563.1.89466 WP_000027563.1.89469 WP_000027563.1.89479 WP_000027563.1.89551 WP_000027563.1.89569 WP_000027563.1.89583 WP_000027563.1.89601 WP_000027563.1.89627 WP_000027563.1.89630 WP_000027563.1.89631 WP_000027563.1.89700 WP_000027563.1.89747 WP_000027563.1.89768 WP_000027563.1.89781 WP_000027563.1.89818 WP_000027563.1.89839 WP_000027563.1.89852 WP_000027563.1.89859 WP_000027563.1.89879 WP_000027563.1.89895 WP_000027563.1.89915 WP_000027563.1.89917 WP_000027563.1.89918 WP_000027563.1.89920 WP_000027563.1.89959 WP_000027563.1.89988 WP_000027563.1.90022 WP_000027563.1.90050 WP_000027563.1.90063 WP_000027563.1.9010 WP_000027563.1.90139 WP_000027563.1.90171 WP_000027563.1.902 WP_000027563.1.90219 WP_000027563.1.90257 WP_000027563.1.90266 WP_000027563.1.90270 WP_000027563.1.90342 WP_000027563.1.90346 WP_000027563.1.90349 WP_000027563.1.90357 WP_000027563.1.9037 WP_000027563.1.90441 WP_000027563.1.90467 WP_000027563.1.90542 WP_000027563.1.90547 WP_000027563.1.9059 WP_000027563.1.90602 WP_000027563.1.9061 WP_000027563.1.90626 WP_000027563.1.90690 WP_000027563.1.90775 WP_000027563.1.9081 WP_000027563.1.90822 WP_000027563.1.90837 WP_000027563.1.90842 WP_000027563.1.90844 WP_000027563.1.90848 WP_000027563.1.90856 WP_000027563.1.90864 WP_000027563.1.9087 WP_000027563.1.90873 WP_000027563.1.909 WP_000027563.1.90905 WP_000027563.1.90924 WP_000027563.1.90960 WP_000027563.1.90967 WP_000027563.1.90979 WP_000027563.1.9098 WP_000027563.1.90988 WP_000027563.1.90996 WP_000027563.1.90997 WP_000027563.1.91007 WP_000027563.1.91072 WP_000027563.1.91088 WP_000027563.1.91113 WP_000027563.1.91143 WP_000027563.1.91153 WP_000027563.1.91182 WP_000027563.1.9119 WP_000027563.1.91266 WP_000027563.1.91268 WP_000027563.1.91288 WP_000027563.1.91290 WP_000027563.1.91354 WP_000027563.1.91356 WP_000027563.1.91361 WP_000027563.1.91384 WP_000027563.1.91397 WP_000027563.1.91425 WP_000027563.1.91482 WP_000027563.1.91485 WP_000027563.1.91515 WP_000027563.1.91543 WP_000027563.1.91548 WP_000027563.1.91549 WP_000027563.1.91565 WP_000027563.1.91566 WP_000027563.1.91626 WP_000027563.1.91651 WP_000027563.1.91672 WP_000027563.1.9168 WP_000027563.1.91685 WP_000027563.1.9171 WP_000027563.1.91739 WP_000027563.1.91756 WP_000027563.1.91782 WP_000027563.1.91787 WP_000027563.1.91801 WP_000027563.1.91814 WP_000027563.1.91843 WP_000027563.1.91850 WP_000027563.1.91871 WP_000027563.1.91879 WP_000027563.1.91887 WP_000027563.1.91893 WP_000027563.1.91951 WP_000027563.1.91959 WP_000027563.1.91971 WP_000027563.1.91994 WP_000027563.1.92014 WP_000027563.1.92025 WP_000027563.1.92048 WP_000027563.1.92053 WP_000027563.1.9209 WP_000027563.1.92096 WP_000027563.1.921 WP_000027563.1.92114 WP_000027563.1.92201 WP_000027563.1.92215 WP_000027563.1.92276 WP_000027563.1.92295 WP_000027563.1.92384 WP_000027563.1.92403 WP_000027563.1.92434 WP_000027563.1.92532 WP_000027563.1.9255 WP_000027563.1.92577 WP_000027563.1.9264 WP_000027563.1.92648 WP_000027563.1.92693 WP_000027563.1.92708 WP_000027563.1.92719 WP_000027563.1.92767 WP_000027563.1.92780 WP_000027563.1.92819 WP_000027563.1.92845 WP_000027563.1.92882 WP_000027563.1.92886 WP_000027563.1.93016 WP_000027563.1.93017 WP_000027563.1.93023 WP_000027563.1.93027 WP_000027563.1.93033 WP_000027563.1.93052 WP_000027563.1.93069 WP_000027563.1.93072 WP_000027563.1.93112 WP_000027563.1.93138 WP_000027563.1.93139 WP_000027563.1.93167 WP_000027563.1.93233 WP_000027563.1.9327 WP_000027563.1.93291 WP_000027563.1.9331 WP_000027563.1.93326 WP_000027563.1.93338 WP_000027563.1.93379 WP_000027563.1.93388 WP_000027563.1.934 WP_000027563.1.93427 WP_000027563.1.93428 WP_000027563.1.93453 WP_000027563.1.93461 WP_000027563.1.93464 WP_000027563.1.93533 WP_000027563.1.93552 WP_000027563.1.9356 WP_000027563.1.93601 WP_000027563.1.93629 WP_000027563.1.93630 WP_000027563.1.93639 WP_000027563.1.93670 WP_000027563.1.93679 WP_000027563.1.93694 WP_000027563.1.93695 WP_000027563.1.93743 WP_000027563.1.93765 WP_000027563.1.93821 WP_000027563.1.93870 WP_000027563.1.93877 WP_000027563.1.93918 WP_000027563.1.93922 WP_000027563.1.93952 WP_000027563.1.94028 WP_000027563.1.94040 WP_000027563.1.94069 WP_000027563.1.94156 WP_000027563.1.9420 WP_000027563.1.94213 WP_000027563.1.94232 WP_000027563.1.9426 WP_000027563.1.94282 WP_000027563.1.94302 WP_000027563.1.94317 WP_000027563.1.94343 WP_000027563.1.94404 WP_000027563.1.94417 WP_000027563.1.94438 WP_000027563.1.94446 WP_000027563.1.94468 WP_000027563.1.94507 WP_000027563.1.94544 WP_000027563.1.94589 WP_000027563.1.94619 WP_000027563.1.94646 WP_000027563.1.94676 WP_000027563.1.94686 WP_000027563.1.94704 WP_000027563.1.94739 WP_000027563.1.9474 WP_000027563.1.94754 WP_000027563.1.94787 WP_000027563.1.94790 WP_000027563.1.94808 WP_000027563.1.94823 WP_000027563.1.94836 WP_000027563.1.94841 WP_000027563.1.94869 WP_000027563.1.94880 WP_000027563.1.94892 WP_000027563.1.94903 WP_000027563.1.94934 WP_000027563.1.94955 WP_000027563.1.94991 WP_000027563.1.94993 WP_000027563.1.94997 WP_000027563.1.95011 WP_000027563.1.95028 WP_000027563.1.95035 WP_000027563.1.95062 WP_000027563.1.95084 WP_000027563.1.95105 WP_000027563.1.95129 WP_000027563.1.9513 WP_000027563.1.95161 WP_000027563.1.95243 WP_000027563.1.95275 WP_000027563.1.95310 WP_000027563.1.95329 WP_000027563.1.95364 WP_000027563.1.95366 WP_000027563.1.95378 WP_000027563.1.95381 WP_000027563.1.95390 WP_000027563.1.95398 WP_000027563.1.95400 WP_000027563.1.95424 WP_000027563.1.95428 WP_000027563.1.95521 WP_000027563.1.95563 WP_000027563.1.95604 WP_000027563.1.95628 WP_000027563.1.95634 WP_000027563.1.95655 WP_000027563.1.9566 WP_000027563.1.95666 WP_000027563.1.95771 WP_000027563.1.95783 WP_000027563.1.95784 WP_000027563.1.95801 WP_000027563.1.95824 WP_000027563.1.95834 WP_000027563.1.95858 WP_000027563.1.95865 WP_000027563.1.95916 WP_000027563.1.95929 WP_000027563.1.95932 WP_000027563.1.96053 WP_000027563.1.96059 WP_000027563.1.96066 WP_000027563.1.96086 WP_000027563.1.96097 WP_000027563.1.96143 WP_000027563.1.96145 WP_000027563.1.9616 WP_000027563.1.96177 WP_000027563.1.96222 WP_000027563.1.96223 WP_000027563.1.96247 WP_000027563.1.96253 WP_000027563.1.96263 WP_000027563.1.96341 WP_000027563.1.9641 WP_000027563.1.96425 WP_000027563.1.96450 WP_000027563.1.96478 WP_000027563.1.96480 WP_000027563.1.9649 WP_000027563.1.96519 WP_000027563.1.96558 WP_000027563.1.96609 WP_000027563.1.9661 WP_000027563.1.96633 WP_000027563.1.96676 WP_000027563.1.9668 WP_000027563.1.9671 WP_000027563.1.96725 WP_000027563.1.96743 WP_000027563.1.96759 WP_000027563.1.96762 WP_000027563.1.96796 WP_000027563.1.96797 WP_000027563.1.96817 WP_000027563.1.96820 WP_000027563.1.96864 WP_000027563.1.96907 WP_000027563.1.96924 WP_000027563.1.96936 WP_000027563.1.96944 WP_000027563.1.97049 WP_000027563.1.97059 WP_000027563.1.97119 WP_000027563.1.97147 WP_000027563.1.97193 WP_000027563.1.97200 WP_000027563.1.97226 WP_000027563.1.97282 WP_000027563.1.9729 WP_000027563.1.97292 WP_000027563.1.97344 WP_000027563.1.97351 WP_000027563.1.97356 WP_000027563.1.97361 WP_000027563.1.97379 WP_000027563.1.97387 WP_000027563.1.9740 WP_000027563.1.97402 WP_000027563.1.97421 WP_000027563.1.97434 WP_000027563.1.97437 WP_000027563.1.97439 WP_000027563.1.97459 WP_000027563.1.97513 WP_000027563.1.97525 WP_000027563.1.97544 WP_000027563.1.97549 WP_000027563.1.97560 WP_000027563.1.97632 WP_000027563.1.97654 WP_000027563.1.97685 WP_000027563.1.9770 WP_000027563.1.97770 WP_000027563.1.97778 WP_000027563.1.97789 WP_000027563.1.97798 WP_000027563.1.97823 WP_000027563.1.97871 WP_000027563.1.97890 WP_000027563.1.97919 WP_000027563.1.97932 WP_000027563.1.97937 WP_000027563.1.97962 WP_000027563.1.97996 WP_000027563.1.98000 WP_000027563.1.9803 WP_000027563.1.98046 WP_000027563.1.98082 WP_000027563.1.98083 WP_000027563.1.981 WP_000027563.1.98102 WP_000027563.1.98115 WP_000027563.1.98155 WP_000027563.1.9816 WP_000027563.1.98167 WP_000027563.1.98176 WP_000027563.1.98187 WP_000027563.1.98202 WP_000027563.1.98205 WP_000027563.1.98232 WP_000027563.1.98251 WP_000027563.1.98279 WP_000027563.1.98312 WP_000027563.1.98357 WP_000027563.1.98384 WP_000027563.1.98404 WP_000027563.1.98429 WP_000027563.1.98480 WP_000027563.1.98484 WP_000027563.1.98543 WP_000027563.1.98549 WP_000027563.1.98569 WP_000027563.1.98578 WP_000027563.1.98614 WP_000027563.1.98633 WP_000027563.1.98654 WP_000027563.1.98665 WP_000027563.1.98702 WP_000027563.1.98727 WP_000027563.1.98757 WP_000027563.1.98775 WP_000027563.1.9883 WP_000027563.1.98849 WP_000027563.1.98875 WP_000027563.1.98920 WP_000027563.1.99006 WP_000027563.1.99046 WP_000027563.1.99060 WP_000027563.1.99101 WP_000027563.1.99182 WP_000027563.1.99234 WP_000027563.1.99265 WP_000027563.1.9930 WP_000027563.1.99304 WP_000027563.1.99306 WP_000027563.1.99307 WP_000027563.1.99334 WP_000027563.1.99361 WP_000027563.1.99392 WP_000027563.1.99401 WP_000027563.1.99458 WP_000027563.1.99471 WP_000027563.1.99472 WP_000027563.1.99475 WP_000027563.1.99487 WP_000027563.1.99498 WP_000027563.1.9950 WP_000027563.1.99501 WP_000027563.1.99511 WP_000027563.1.99549 WP_000027563.1.99571 WP_000027563.1.99592 WP_000027563.1.99619 WP_000027563.1.99632 WP_000027563.1.99692 WP_000027563.1.99694 WP_000027563.1.99771 WP_000027563.1.99782 WP_000027563.1.99804 WP_000027563.1.99869 WP_000027563.1.99874 WP_000027563.1.99891 WP_000027563.1.99986 YP_002412436.1.14968 YP_006119791.1.29421 YP_006779338.1.12065 YP_403336.1.10455 gi|218558378|ref|YP_002391291.1| gi|218704917|ref|YP_002412436.1| gi|82776987|ref|YP_403336.1| gi|387506662|ref|YP_006158918.1| gi|387829425|ref|YP_003349362.1| gi|110641628|ref|YP_669358.1| gi|386638964|ref|YP_006105762.1| gi|15831306|ref|NP_310079.1| gi|218689376|ref|YP_002397588.1| gi|260855173|ref|YP_003229064.1| Z2271_ECO57 gi|260867893|ref|YP_003234295.1| gi|215486684|ref|YP_002329115.1| gi|386604550|ref|YP_006110850.1| gi|387882464|ref|YP_006312766.1| gi|407469148|ref|YP_006784410.1| gi|222156191|ref|YP_002556330.1| gi|386613946|ref|YP_006133612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]