SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15831544|ref|NP_310317.1| from Escherichia coli O157:H7 str. Sakai

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15831544|ref|NP_310317.1|
Domain Number 1 Region: 7-169
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.45e-56
Family SCOPe 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15831544|ref|NP_310317.1|
Sequence length 186
Comment spermidine N1-acetyltransferase [Escherichia coli O157:H7 str. Sakai]
Sequence
MPSAHSVKLRPLEREDLRYVHQLDNNASVMRYWFEEPYEAFVELSDLYDKHIHDQSERRF
VVECDGEKAGLVELVEINHVHRRAEFQIIISPEYQGKGLATRAAKLAMDYGFTVLNLYKL
YLIVDKENEKAIHIYRKLGFSVEGELMHEFFINGQYRNAIRMCIFQHQYLAEHKTPGQTL
LKPTAQ
Download sequence
Identical sequences A0A026V4L9 A0A027TZV1 A0A069XQE7 A0A070FS69 A0A070ST97 A0A070V2J4 A0A073FYB5 A0A074I280 A0A080FYW5 A0A0E1M200 A0A0E1SUK3 A0A0F6C4M6 A0A0F6F6S4 A0A0H3PMT2 A0A0M7PR30 A0A125X321 A0A140N9J4 A0A142H332 A0A1H0ENE9 A0A1S6TAS3 A0A1X3IM89 A0A1X3JFN8 A0A1X3L368 A0A1Z3V5D0 A0A238BE02 A0A2A2XNG1 A0A2H1BEG1 A7ZM43 B6IB18 C3T9H2 C8U8Q4 C8UQ77 D3QTU1 D6HX67 D7XVV2 D7Y590 E0IWX6 E1IK72 E1J460 E3PMG1 E6BT82 F4NFU3 F4SJA3 G0F1K2 H4UJ72 I0VM51 I2SSH2 I2UIW1 I2WDU6 I2WU89 I2XE90 J7RTD9 K4UZZ5 L2V261 P0A951 P0A952 S1D912 S1EL21 S1H8F6 S1I7U8 T9D1U3 U9XZ33 V0AJ54 V2QT97 V8FGB7 W1EXY8
gi|251785042|ref|YP_002999346.1| gi|388477659|ref|YP_489847.1| 6cy6_A gi|251785042|ref|YP_002999346.1| gi|387621301|ref|YP_006128928.1| gi|238900799|ref|YP_002926595.1| gi|260868076|ref|YP_003234478.1| gi|209398880|ref|YP_002270655.1| gi|157156145|ref|YP_001462872.1| gi|471333427|ref|YP_007556904.1| gi|254161645|ref|YP_003044753.1| gi|157161043|ref|YP_001458361.1| gi|386709440|ref|YP_006173161.1| gi|386709440|ref|YP_006173161.1| gi|387882690|ref|YP_006312992.1| gi|387612075|ref|YP_006115191.1| ATDA_ECO57 ER42 gi|218554151|ref|YP_002387064.1| NP_310317.1.58667 NP_416101.1.90541 WP_001138581.1.10001 WP_001138581.1.100044 WP_001138581.1.100066 WP_001138581.1.100073 WP_001138581.1.100085 WP_001138581.1.10010 WP_001138581.1.100111 WP_001138581.1.100159 WP_001138581.1.100185 WP_001138581.1.100251 WP_001138581.1.100252 WP_001138581.1.100283 WP_001138581.1.100299 WP_001138581.1.100302 WP_001138581.1.10034 WP_001138581.1.100425 WP_001138581.1.100441 WP_001138581.1.100444 WP_001138581.1.100487 WP_001138581.1.100496 WP_001138581.1.100508 WP_001138581.1.10051 WP_001138581.1.100543 WP_001138581.1.100554 WP_001138581.1.100571 WP_001138581.1.100573 WP_001138581.1.10067 WP_001138581.1.100753 WP_001138581.1.100758 WP_001138581.1.100778 WP_001138581.1.100796 WP_001138581.1.100824 WP_001138581.1.100836 WP_001138581.1.100868 WP_001138581.1.100925 WP_001138581.1.100928 WP_001138581.1.10094 WP_001138581.1.100966 WP_001138581.1.100990 WP_001138581.1.101033 WP_001138581.1.101096 WP_001138581.1.101102 WP_001138581.1.101105 WP_001138581.1.101158 WP_001138581.1.101166 WP_001138581.1.101186 WP_001138581.1.101206 WP_001138581.1.101257 WP_001138581.1.10126 WP_001138581.1.101282 WP_001138581.1.101289 WP_001138581.1.101293 WP_001138581.1.101418 WP_001138581.1.101423 WP_001138581.1.101436 WP_001138581.1.101468 WP_001138581.1.10154 WP_001138581.1.101583 WP_001138581.1.101628 WP_001138581.1.101630 WP_001138581.1.101651 WP_001138581.1.101654 WP_001138581.1.101686 WP_001138581.1.10173 WP_001138581.1.101737 WP_001138581.1.101747 WP_001138581.1.101786 WP_001138581.1.101822 WP_001138581.1.10184 WP_001138581.1.101865 WP_001138581.1.10188 WP_001138581.1.10190 WP_001138581.1.101900 WP_001138581.1.101908 WP_001138581.1.101947 WP_001138581.1.101952 WP_001138581.1.10206 WP_001138581.1.102094 WP_001138581.1.102122 WP_001138581.1.102139 WP_001138581.1.10233 WP_001138581.1.10235 WP_001138581.1.10252 WP_001138581.1.10273 WP_001138581.1.10304 WP_001138581.1.10335 WP_001138581.1.10379 WP_001138581.1.1040 WP_001138581.1.10400 WP_001138581.1.10417 WP_001138581.1.10476 WP_001138581.1.10491 WP_001138581.1.10496 WP_001138581.1.1058 WP_001138581.1.1071 WP_001138581.1.1073 WP_001138581.1.1074 WP_001138581.1.10761 WP_001138581.1.10798 WP_001138581.1.10833 WP_001138581.1.10922 WP_001138581.1.10940 WP_001138581.1.10970 WP_001138581.1.10988 WP_001138581.1.10989 WP_001138581.1.11006 WP_001138581.1.11032 WP_001138581.1.11047 WP_001138581.1.11071 WP_001138581.1.11091 WP_001138581.1.1111 WP_001138581.1.11118 WP_001138581.1.11121 WP_001138581.1.1113 WP_001138581.1.11133 WP_001138581.1.1122 WP_001138581.1.11240 WP_001138581.1.11241 WP_001138581.1.11301 WP_001138581.1.11408 WP_001138581.1.11418 WP_001138581.1.11420 WP_001138581.1.11437 WP_001138581.1.11524 WP_001138581.1.11578 WP_001138581.1.11616 WP_001138581.1.11645 WP_001138581.1.11671 WP_001138581.1.1168 WP_001138581.1.11690 WP_001138581.1.11699 WP_001138581.1.11748 WP_001138581.1.11759 WP_001138581.1.11844 WP_001138581.1.1186 WP_001138581.1.11955 WP_001138581.1.1196 WP_001138581.1.11982 WP_001138581.1.12030 WP_001138581.1.12036 WP_001138581.1.12060 WP_001138581.1.1212 WP_001138581.1.12259 WP_001138581.1.12279 WP_001138581.1.12305 WP_001138581.1.12319 WP_001138581.1.12320 WP_001138581.1.12342 WP_001138581.1.12415 WP_001138581.1.1242 WP_001138581.1.12458 WP_001138581.1.12468 WP_001138581.1.12478 WP_001138581.1.12542 WP_001138581.1.12552 WP_001138581.1.12558 WP_001138581.1.12566 WP_001138581.1.12582 WP_001138581.1.12594 WP_001138581.1.12623 WP_001138581.1.12645 WP_001138581.1.12675 WP_001138581.1.12693 WP_001138581.1.127 WP_001138581.1.12743 WP_001138581.1.1275 WP_001138581.1.12756 WP_001138581.1.12762 WP_001138581.1.12775 WP_001138581.1.12781 WP_001138581.1.12831 WP_001138581.1.12876 WP_001138581.1.12911 WP_001138581.1.12914 WP_001138581.1.1295 WP_001138581.1.12979 WP_001138581.1.13002 WP_001138581.1.13015 WP_001138581.1.13031 WP_001138581.1.13060 WP_001138581.1.13074 WP_001138581.1.1312 WP_001138581.1.13136 WP_001138581.1.1315 WP_001138581.1.13162 WP_001138581.1.13176 WP_001138581.1.13217 WP_001138581.1.13223 WP_001138581.1.13239 WP_001138581.1.13252 WP_001138581.1.13258 WP_001138581.1.13278 WP_001138581.1.13281 WP_001138581.1.13332 WP_001138581.1.13333 WP_001138581.1.13348 WP_001138581.1.1335 WP_001138581.1.13430 WP_001138581.1.13437 WP_001138581.1.13442 WP_001138581.1.1345 WP_001138581.1.13481 WP_001138581.1.13492 WP_001138581.1.13495 WP_001138581.1.13525 WP_001138581.1.13585 WP_001138581.1.13601 WP_001138581.1.13608 WP_001138581.1.13618 WP_001138581.1.13624 WP_001138581.1.13644 WP_001138581.1.13664 WP_001138581.1.13672 WP_001138581.1.13824 WP_001138581.1.13877 WP_001138581.1.13881 WP_001138581.1.13924 WP_001138581.1.13936 WP_001138581.1.13939 WP_001138581.1.13949 WP_001138581.1.13974 WP_001138581.1.14030 WP_001138581.1.14058 WP_001138581.1.14062 WP_001138581.1.14110 WP_001138581.1.1419 WP_001138581.1.14292 WP_001138581.1.14346 WP_001138581.1.1438 WP_001138581.1.1439 WP_001138581.1.14398 WP_001138581.1.14417 WP_001138581.1.14432 WP_001138581.1.14453 WP_001138581.1.14468 WP_001138581.1.14493 WP_001138581.1.14501 WP_001138581.1.14529 WP_001138581.1.14536 WP_001138581.1.14600 WP_001138581.1.14601 WP_001138581.1.1461 WP_001138581.1.14621 WP_001138581.1.14661 WP_001138581.1.14672 WP_001138581.1.14678 WP_001138581.1.1470 WP_001138581.1.14748 WP_001138581.1.14811 WP_001138581.1.14833 WP_001138581.1.14871 WP_001138581.1.14879 WP_001138581.1.14956 WP_001138581.1.14977 WP_001138581.1.14992 WP_001138581.1.14993 WP_001138581.1.15087 WP_001138581.1.15117 WP_001138581.1.1512 WP_001138581.1.15121 WP_001138581.1.15138 WP_001138581.1.15177 WP_001138581.1.15193 WP_001138581.1.1524 WP_001138581.1.15259 WP_001138581.1.15282 WP_001138581.1.153 WP_001138581.1.15300 WP_001138581.1.15332 WP_001138581.1.15335 WP_001138581.1.15356 WP_001138581.1.15377 WP_001138581.1.15416 WP_001138581.1.1543 WP_001138581.1.15444 WP_001138581.1.15469 WP_001138581.1.15496 WP_001138581.1.15503 WP_001138581.1.15527 WP_001138581.1.15528 WP_001138581.1.15538 WP_001138581.1.15576 WP_001138581.1.1559 WP_001138581.1.15593 WP_001138581.1.1561 WP_001138581.1.15620 WP_001138581.1.15626 WP_001138581.1.15645 WP_001138581.1.15702 WP_001138581.1.15707 WP_001138581.1.15740 WP_001138581.1.15747 WP_001138581.1.15752 WP_001138581.1.15782 WP_001138581.1.15791 WP_001138581.1.15809 WP_001138581.1.1582 WP_001138581.1.1588 WP_001138581.1.15983 WP_001138581.1.16075 WP_001138581.1.16086 WP_001138581.1.1609 WP_001138581.1.16102 WP_001138581.1.16111 WP_001138581.1.16133 WP_001138581.1.16154 WP_001138581.1.16171 WP_001138581.1.16179 WP_001138581.1.16194 WP_001138581.1.1621 WP_001138581.1.16222 WP_001138581.1.16272 WP_001138581.1.16294 WP_001138581.1.163 WP_001138581.1.1634 WP_001138581.1.16435 WP_001138581.1.16463 WP_001138581.1.16481 WP_001138581.1.16500 WP_001138581.1.16539 WP_001138581.1.16541 WP_001138581.1.1655 WP_001138581.1.16577 WP_001138581.1.16592 WP_001138581.1.16612 WP_001138581.1.16648 WP_001138581.1.16715 WP_001138581.1.16721 WP_001138581.1.1673 WP_001138581.1.16752 WP_001138581.1.16845 WP_001138581.1.16861 WP_001138581.1.16992 WP_001138581.1.17018 WP_001138581.1.17028 WP_001138581.1.17084 WP_001138581.1.17087 WP_001138581.1.17109 WP_001138581.1.17111 WP_001138581.1.17114 WP_001138581.1.17119 WP_001138581.1.17150 WP_001138581.1.17187 WP_001138581.1.17267 WP_001138581.1.17282 WP_001138581.1.17290 WP_001138581.1.17297 WP_001138581.1.1731 WP_001138581.1.17356 WP_001138581.1.17360 WP_001138581.1.17373 WP_001138581.1.17386 WP_001138581.1.17392 WP_001138581.1.17410 WP_001138581.1.17415 WP_001138581.1.17417 WP_001138581.1.17432 WP_001138581.1.17515 WP_001138581.1.17534 WP_001138581.1.1755 WP_001138581.1.17577 WP_001138581.1.17595 WP_001138581.1.17623 WP_001138581.1.1763 WP_001138581.1.17637 WP_001138581.1.1766 WP_001138581.1.17701 WP_001138581.1.17802 WP_001138581.1.17829 WP_001138581.1.17831 WP_001138581.1.17889 WP_001138581.1.17904 WP_001138581.1.17952 WP_001138581.1.17961 WP_001138581.1.17963 WP_001138581.1.17984 WP_001138581.1.18000 WP_001138581.1.18006 WP_001138581.1.18094 WP_001138581.1.18112 WP_001138581.1.18133 WP_001138581.1.18134 WP_001138581.1.18136 WP_001138581.1.18175 WP_001138581.1.18226 WP_001138581.1.18326 WP_001138581.1.18329 WP_001138581.1.1834 WP_001138581.1.18340 WP_001138581.1.18381 WP_001138581.1.18402 WP_001138581.1.18410 WP_001138581.1.18436 WP_001138581.1.1844 WP_001138581.1.18482 WP_001138581.1.18550 WP_001138581.1.18588 WP_001138581.1.18649 WP_001138581.1.1866 WP_001138581.1.1867 WP_001138581.1.18699 WP_001138581.1.18714 WP_001138581.1.18726 WP_001138581.1.188 WP_001138581.1.1881 WP_001138581.1.18837 WP_001138581.1.18858 WP_001138581.1.18874 WP_001138581.1.18876 WP_001138581.1.18923 WP_001138581.1.18936 WP_001138581.1.18995 WP_001138581.1.19039 WP_001138581.1.19075 WP_001138581.1.191 WP_001138581.1.19100 WP_001138581.1.19114 WP_001138581.1.19140 WP_001138581.1.19150 WP_001138581.1.19194 WP_001138581.1.19205 WP_001138581.1.19206 WP_001138581.1.19277 WP_001138581.1.19297 WP_001138581.1.193 WP_001138581.1.19312 WP_001138581.1.19313 WP_001138581.1.19314 WP_001138581.1.19332 WP_001138581.1.19347 WP_001138581.1.19350 WP_001138581.1.19361 WP_001138581.1.19389 WP_001138581.1.19397 WP_001138581.1.19419 WP_001138581.1.19424 WP_001138581.1.19441 WP_001138581.1.19448 WP_001138581.1.19478 WP_001138581.1.19494 WP_001138581.1.19557 WP_001138581.1.1963 WP_001138581.1.19655 WP_001138581.1.19661 WP_001138581.1.19691 WP_001138581.1.19795 WP_001138581.1.1982 WP_001138581.1.19840 WP_001138581.1.19847 WP_001138581.1.19878 WP_001138581.1.19889 WP_001138581.1.19940 WP_001138581.1.19957 WP_001138581.1.19994 WP_001138581.1.2005 WP_001138581.1.20129 WP_001138581.1.20151 WP_001138581.1.20157 WP_001138581.1.20164 WP_001138581.1.20166 WP_001138581.1.20183 WP_001138581.1.20215 WP_001138581.1.20251 WP_001138581.1.20264 WP_001138581.1.20308 WP_001138581.1.20318 WP_001138581.1.20325 WP_001138581.1.20331 WP_001138581.1.20445 WP_001138581.1.20449 WP_001138581.1.20480 WP_001138581.1.20506 WP_001138581.1.20515 WP_001138581.1.20519 WP_001138581.1.20536 WP_001138581.1.20546 WP_001138581.1.20565 WP_001138581.1.20594 WP_001138581.1.20596 WP_001138581.1.2063 WP_001138581.1.20638 WP_001138581.1.20662 WP_001138581.1.20691 WP_001138581.1.20724 WP_001138581.1.20730 WP_001138581.1.20737 WP_001138581.1.20745 WP_001138581.1.20785 WP_001138581.1.20824 WP_001138581.1.20893 WP_001138581.1.2094 WP_001138581.1.20941 WP_001138581.1.20943 WP_001138581.1.20950 WP_001138581.1.20958 WP_001138581.1.20982 WP_001138581.1.20989 WP_001138581.1.2100 WP_001138581.1.21017 WP_001138581.1.21020 WP_001138581.1.21033 WP_001138581.1.21041 WP_001138581.1.21057 WP_001138581.1.21104 WP_001138581.1.21122 WP_001138581.1.21137 WP_001138581.1.21251 WP_001138581.1.21320 WP_001138581.1.21336 WP_001138581.1.2142 WP_001138581.1.21470 WP_001138581.1.21508 WP_001138581.1.21519 WP_001138581.1.2156 WP_001138581.1.21573 WP_001138581.1.2164 WP_001138581.1.21656 WP_001138581.1.21661 WP_001138581.1.21666 WP_001138581.1.21667 WP_001138581.1.21668 WP_001138581.1.21696 WP_001138581.1.21733 WP_001138581.1.21758 WP_001138581.1.21771 WP_001138581.1.21812 WP_001138581.1.21823 WP_001138581.1.21915 WP_001138581.1.21948 WP_001138581.1.21962 WP_001138581.1.22060 WP_001138581.1.22113 WP_001138581.1.22138 WP_001138581.1.2218 WP_001138581.1.22195 WP_001138581.1.22251 WP_001138581.1.22291 WP_001138581.1.22304 WP_001138581.1.22314 WP_001138581.1.22325 WP_001138581.1.22350 WP_001138581.1.22359 WP_001138581.1.22363 WP_001138581.1.22381 WP_001138581.1.22450 WP_001138581.1.22544 WP_001138581.1.22574 WP_001138581.1.22579 WP_001138581.1.22594 WP_001138581.1.22599 WP_001138581.1.22631 WP_001138581.1.22632 WP_001138581.1.22649 WP_001138581.1.22662 WP_001138581.1.22669 WP_001138581.1.22690 WP_001138581.1.22743 WP_001138581.1.22756 WP_001138581.1.22783 WP_001138581.1.22830 WP_001138581.1.22868 WP_001138581.1.22875 WP_001138581.1.22885 WP_001138581.1.22908 WP_001138581.1.22925 WP_001138581.1.23005 WP_001138581.1.23026 WP_001138581.1.23035 WP_001138581.1.23044 WP_001138581.1.23073 WP_001138581.1.23078 WP_001138581.1.23090 WP_001138581.1.23092 WP_001138581.1.23105 WP_001138581.1.23115 WP_001138581.1.23135 WP_001138581.1.23241 WP_001138581.1.23285 WP_001138581.1.23323 WP_001138581.1.23355 WP_001138581.1.23376 WP_001138581.1.23378 WP_001138581.1.23383 WP_001138581.1.23467 WP_001138581.1.23486 WP_001138581.1.23487 WP_001138581.1.23511 WP_001138581.1.23527 WP_001138581.1.23549 WP_001138581.1.2362 WP_001138581.1.23676 WP_001138581.1.23790 WP_001138581.1.23806 WP_001138581.1.23812 WP_001138581.1.23838 WP_001138581.1.2388 WP_001138581.1.23895 WP_001138581.1.23899 WP_001138581.1.23915 WP_001138581.1.23945 WP_001138581.1.23950 WP_001138581.1.23973 WP_001138581.1.23984 WP_001138581.1.24024 WP_001138581.1.24045 WP_001138581.1.24068 WP_001138581.1.24070 WP_001138581.1.24122 WP_001138581.1.24136 WP_001138581.1.2418 WP_001138581.1.24278 WP_001138581.1.2428 WP_001138581.1.24283 WP_001138581.1.2430 WP_001138581.1.24304 WP_001138581.1.24316 WP_001138581.1.24341 WP_001138581.1.24362 WP_001138581.1.24374 WP_001138581.1.24383 WP_001138581.1.24458 WP_001138581.1.24485 WP_001138581.1.24499 WP_001138581.1.24583 WP_001138581.1.24616 WP_001138581.1.24642 WP_001138581.1.24650 WP_001138581.1.24693 WP_001138581.1.24695 WP_001138581.1.24753 WP_001138581.1.2479 WP_001138581.1.24849 WP_001138581.1.24870 WP_001138581.1.24899 WP_001138581.1.24929 WP_001138581.1.24946 WP_001138581.1.24960 WP_001138581.1.24984 WP_001138581.1.25019 WP_001138581.1.25039 WP_001138581.1.2504 WP_001138581.1.25042 WP_001138581.1.25076 WP_001138581.1.25082 WP_001138581.1.25085 WP_001138581.1.25087 WP_001138581.1.25088 WP_001138581.1.25126 WP_001138581.1.25141 WP_001138581.1.25183 WP_001138581.1.25201 WP_001138581.1.25203 WP_001138581.1.25305 WP_001138581.1.2531 WP_001138581.1.25312 WP_001138581.1.25324 WP_001138581.1.25378 WP_001138581.1.25414 WP_001138581.1.2543 WP_001138581.1.25526 WP_001138581.1.25548 WP_001138581.1.25577 WP_001138581.1.25643 WP_001138581.1.25713 WP_001138581.1.25726 WP_001138581.1.25755 WP_001138581.1.25794 WP_001138581.1.25819 WP_001138581.1.25831 WP_001138581.1.25832 WP_001138581.1.25843 WP_001138581.1.25945 WP_001138581.1.25996 WP_001138581.1.26048 WP_001138581.1.26055 WP_001138581.1.26061 WP_001138581.1.26066 WP_001138581.1.26105 WP_001138581.1.26121 WP_001138581.1.26134 WP_001138581.1.26150 WP_001138581.1.26161 WP_001138581.1.26191 WP_001138581.1.26246 WP_001138581.1.26264 WP_001138581.1.26331 WP_001138581.1.26379 WP_001138581.1.26391 WP_001138581.1.26401 WP_001138581.1.26403 WP_001138581.1.26474 WP_001138581.1.26479 WP_001138581.1.26480 WP_001138581.1.26517 WP_001138581.1.26525 WP_001138581.1.26569 WP_001138581.1.26590 WP_001138581.1.26598 WP_001138581.1.26609 WP_001138581.1.26644 WP_001138581.1.26683 WP_001138581.1.26716 WP_001138581.1.26761 WP_001138581.1.26878 WP_001138581.1.26941 WP_001138581.1.26943 WP_001138581.1.26975 WP_001138581.1.26998 WP_001138581.1.27019 WP_001138581.1.27057 WP_001138581.1.27098 WP_001138581.1.27101 WP_001138581.1.2712 WP_001138581.1.27134 WP_001138581.1.27141 WP_001138581.1.27175 WP_001138581.1.27214 WP_001138581.1.27234 WP_001138581.1.27260 WP_001138581.1.27280 WP_001138581.1.27287 WP_001138581.1.27292 WP_001138581.1.27310 WP_001138581.1.27330 WP_001138581.1.27338 WP_001138581.1.27367 WP_001138581.1.27373 WP_001138581.1.27424 WP_001138581.1.27445 WP_001138581.1.27451 WP_001138581.1.27504 WP_001138581.1.27524 WP_001138581.1.2755 WP_001138581.1.27560 WP_001138581.1.27611 WP_001138581.1.27698 WP_001138581.1.27723 WP_001138581.1.27741 WP_001138581.1.27742 WP_001138581.1.27749 WP_001138581.1.27758 WP_001138581.1.27774 WP_001138581.1.27876 WP_001138581.1.27879 WP_001138581.1.27923 WP_001138581.1.27971 WP_001138581.1.28109 WP_001138581.1.2811 WP_001138581.1.28110 WP_001138581.1.28128 WP_001138581.1.28143 WP_001138581.1.2826 WP_001138581.1.28268 WP_001138581.1.28271 WP_001138581.1.28305 WP_001138581.1.28371 WP_001138581.1.28401 WP_001138581.1.28496 WP_001138581.1.28509 WP_001138581.1.28523 WP_001138581.1.28540 WP_001138581.1.28551 WP_001138581.1.28554 WP_001138581.1.28662 WP_001138581.1.28697 WP_001138581.1.28711 WP_001138581.1.28734 WP_001138581.1.28809 WP_001138581.1.2881 WP_001138581.1.28879 WP_001138581.1.28919 WP_001138581.1.28950 WP_001138581.1.28953 WP_001138581.1.28982 WP_001138581.1.28994 WP_001138581.1.29001 WP_001138581.1.29013 WP_001138581.1.29026 WP_001138581.1.29055 WP_001138581.1.29061 WP_001138581.1.29082 WP_001138581.1.291 WP_001138581.1.29125 WP_001138581.1.29126 WP_001138581.1.29128 WP_001138581.1.29150 WP_001138581.1.29176 WP_001138581.1.29194 WP_001138581.1.29221 WP_001138581.1.29239 WP_001138581.1.2926 WP_001138581.1.29404 WP_001138581.1.2945 WP_001138581.1.29495 WP_001138581.1.29503 WP_001138581.1.2954 WP_001138581.1.29564 WP_001138581.1.29590 WP_001138581.1.29597 WP_001138581.1.29618 WP_001138581.1.29669 WP_001138581.1.29683 WP_001138581.1.29689 WP_001138581.1.29724 WP_001138581.1.29746 WP_001138581.1.29752 WP_001138581.1.2978 WP_001138581.1.29812 WP_001138581.1.29818 WP_001138581.1.29840 WP_001138581.1.29874 WP_001138581.1.29976 WP_001138581.1.29992 WP_001138581.1.30 WP_001138581.1.30019 WP_001138581.1.30052 WP_001138581.1.30064 WP_001138581.1.30098 WP_001138581.1.30105 WP_001138581.1.30164 WP_001138581.1.30231 WP_001138581.1.30247 WP_001138581.1.30253 WP_001138581.1.30428 WP_001138581.1.3045 WP_001138581.1.30452 WP_001138581.1.30472 WP_001138581.1.30476 WP_001138581.1.30479 WP_001138581.1.30497 WP_001138581.1.30546 WP_001138581.1.30630 WP_001138581.1.30637 WP_001138581.1.30639 WP_001138581.1.30742 WP_001138581.1.30749 WP_001138581.1.30783 WP_001138581.1.30843 WP_001138581.1.30866 WP_001138581.1.30906 WP_001138581.1.30918 WP_001138581.1.30993 WP_001138581.1.30999 WP_001138581.1.31000 WP_001138581.1.31009 WP_001138581.1.31055 WP_001138581.1.31089 WP_001138581.1.31142 WP_001138581.1.312 WP_001138581.1.31211 WP_001138581.1.31252 WP_001138581.1.31295 WP_001138581.1.31340 WP_001138581.1.31379 WP_001138581.1.3140 WP_001138581.1.31401 WP_001138581.1.31407 WP_001138581.1.31421 WP_001138581.1.31429 WP_001138581.1.31431 WP_001138581.1.31506 WP_001138581.1.31575 WP_001138581.1.31614 WP_001138581.1.31681 WP_001138581.1.31709 WP_001138581.1.31715 WP_001138581.1.31740 WP_001138581.1.31803 WP_001138581.1.3181 WP_001138581.1.31833 WP_001138581.1.31835 WP_001138581.1.31839 WP_001138581.1.31860 WP_001138581.1.31866 WP_001138581.1.31898 WP_001138581.1.31924 WP_001138581.1.31928 WP_001138581.1.31956 WP_001138581.1.31978 WP_001138581.1.32020 WP_001138581.1.32037 WP_001138581.1.32063 WP_001138581.1.32093 WP_001138581.1.32121 WP_001138581.1.32127 WP_001138581.1.32143 WP_001138581.1.32184 WP_001138581.1.322 WP_001138581.1.32232 WP_001138581.1.32243 WP_001138581.1.32287 WP_001138581.1.32394 WP_001138581.1.32406 WP_001138581.1.32479 WP_001138581.1.32494 WP_001138581.1.32536 WP_001138581.1.32574 WP_001138581.1.32590 WP_001138581.1.32591 WP_001138581.1.32601 WP_001138581.1.32661 WP_001138581.1.32680 WP_001138581.1.32709 WP_001138581.1.32722 WP_001138581.1.32811 WP_001138581.1.32835 WP_001138581.1.32888 WP_001138581.1.32903 WP_001138581.1.32910 WP_001138581.1.32931 WP_001138581.1.32959 WP_001138581.1.32984 WP_001138581.1.32992 WP_001138581.1.33004 WP_001138581.1.33014 WP_001138581.1.33049 WP_001138581.1.33055 WP_001138581.1.33094 WP_001138581.1.33125 WP_001138581.1.33146 WP_001138581.1.33167 WP_001138581.1.33178 WP_001138581.1.33238 WP_001138581.1.33244 WP_001138581.1.33268 WP_001138581.1.33325 WP_001138581.1.33385 WP_001138581.1.33408 WP_001138581.1.33422 WP_001138581.1.33424 WP_001138581.1.33475 WP_001138581.1.33502 WP_001138581.1.33512 WP_001138581.1.33526 WP_001138581.1.3354 WP_001138581.1.33565 WP_001138581.1.33595 WP_001138581.1.33648 WP_001138581.1.33680 WP_001138581.1.33736 WP_001138581.1.33745 WP_001138581.1.33746 WP_001138581.1.33799 WP_001138581.1.33823 WP_001138581.1.33853 WP_001138581.1.33854 WP_001138581.1.33879 WP_001138581.1.33888 WP_001138581.1.33914 WP_001138581.1.33952 WP_001138581.1.33973 WP_001138581.1.33974 WP_001138581.1.3398 WP_001138581.1.33981 WP_001138581.1.3401 WP_001138581.1.34032 WP_001138581.1.34094 WP_001138581.1.3411 WP_001138581.1.34124 WP_001138581.1.342 WP_001138581.1.34204 WP_001138581.1.34206 WP_001138581.1.34224 WP_001138581.1.34269 WP_001138581.1.34270 WP_001138581.1.34273 WP_001138581.1.34277 WP_001138581.1.34332 WP_001138581.1.34341 WP_001138581.1.34363 WP_001138581.1.34383 WP_001138581.1.34397 WP_001138581.1.34444 WP_001138581.1.34464 WP_001138581.1.34500 WP_001138581.1.34525 WP_001138581.1.34532 WP_001138581.1.34538 WP_001138581.1.34605 WP_001138581.1.34680 WP_001138581.1.34682 WP_001138581.1.34686 WP_001138581.1.34727 WP_001138581.1.34781 WP_001138581.1.34782 WP_001138581.1.34794 WP_001138581.1.34982 WP_001138581.1.34990 WP_001138581.1.34993 WP_001138581.1.35180 WP_001138581.1.35195 WP_001138581.1.35202 WP_001138581.1.35204 WP_001138581.1.35208 WP_001138581.1.35211 WP_001138581.1.35316 WP_001138581.1.35360 WP_001138581.1.35365 WP_001138581.1.35376 WP_001138581.1.3539 WP_001138581.1.35393 WP_001138581.1.35464 WP_001138581.1.35466 WP_001138581.1.35468 WP_001138581.1.3550 WP_001138581.1.35552 WP_001138581.1.35581 WP_001138581.1.3560 WP_001138581.1.35651 WP_001138581.1.35653 WP_001138581.1.35704 WP_001138581.1.35724 WP_001138581.1.35904 WP_001138581.1.35922 WP_001138581.1.35927 WP_001138581.1.35934 WP_001138581.1.35959 WP_001138581.1.36010 WP_001138581.1.36070 WP_001138581.1.36071 WP_001138581.1.36085 WP_001138581.1.36094 WP_001138581.1.36164 WP_001138581.1.36166 WP_001138581.1.36182 WP_001138581.1.36212 WP_001138581.1.36334 WP_001138581.1.36386 WP_001138581.1.36393 WP_001138581.1.36426 WP_001138581.1.36496 WP_001138581.1.36507 WP_001138581.1.36523 WP_001138581.1.36531 WP_001138581.1.36610 WP_001138581.1.36626 WP_001138581.1.3671 WP_001138581.1.36739 WP_001138581.1.36746 WP_001138581.1.36747 WP_001138581.1.36767 WP_001138581.1.36806 WP_001138581.1.36817 WP_001138581.1.36826 WP_001138581.1.36833 WP_001138581.1.37020 WP_001138581.1.37099 WP_001138581.1.37102 WP_001138581.1.37122 WP_001138581.1.37206 WP_001138581.1.3723 WP_001138581.1.37233 WP_001138581.1.37252 WP_001138581.1.37261 WP_001138581.1.37329 WP_001138581.1.37334 WP_001138581.1.37337 WP_001138581.1.37372 WP_001138581.1.37433 WP_001138581.1.37445 WP_001138581.1.37485 WP_001138581.1.37510 WP_001138581.1.37576 WP_001138581.1.37588 WP_001138581.1.3762 WP_001138581.1.37634 WP_001138581.1.37731 WP_001138581.1.37750 WP_001138581.1.37762 WP_001138581.1.37766 WP_001138581.1.37769 WP_001138581.1.37773 WP_001138581.1.3788 WP_001138581.1.37887 WP_001138581.1.37897 WP_001138581.1.37926 WP_001138581.1.3795 WP_001138581.1.37964 WP_001138581.1.37995 WP_001138581.1.38033 WP_001138581.1.38050 WP_001138581.1.38063 WP_001138581.1.38080 WP_001138581.1.38081 WP_001138581.1.38085 WP_001138581.1.38103 WP_001138581.1.38105 WP_001138581.1.38107 WP_001138581.1.3811 WP_001138581.1.38120 WP_001138581.1.3815 WP_001138581.1.38155 WP_001138581.1.38182 WP_001138581.1.38211 WP_001138581.1.3822 WP_001138581.1.38257 WP_001138581.1.38306 WP_001138581.1.38314 WP_001138581.1.38323 WP_001138581.1.38363 WP_001138581.1.38369 WP_001138581.1.38371 WP_001138581.1.38485 WP_001138581.1.38533 WP_001138581.1.38544 WP_001138581.1.38584 WP_001138581.1.38626 WP_001138581.1.38636 WP_001138581.1.38694 WP_001138581.1.38835 WP_001138581.1.38843 WP_001138581.1.38896 WP_001138581.1.389 WP_001138581.1.38911 WP_001138581.1.38920 WP_001138581.1.38935 WP_001138581.1.38950 WP_001138581.1.38956 WP_001138581.1.38958 WP_001138581.1.39037 WP_001138581.1.3904 WP_001138581.1.39042 WP_001138581.1.39123 WP_001138581.1.39164 WP_001138581.1.39167 WP_001138581.1.39180 WP_001138581.1.39249 WP_001138581.1.39268 WP_001138581.1.39305 WP_001138581.1.39310 WP_001138581.1.39342 WP_001138581.1.39356 WP_001138581.1.39365 WP_001138581.1.39415 WP_001138581.1.39430 WP_001138581.1.39481 WP_001138581.1.39531 WP_001138581.1.3954 WP_001138581.1.39541 WP_001138581.1.39564 WP_001138581.1.39601 WP_001138581.1.39606 WP_001138581.1.39610 WP_001138581.1.39636 WP_001138581.1.39646 WP_001138581.1.3970 WP_001138581.1.39758 WP_001138581.1.39780 WP_001138581.1.3980 WP_001138581.1.39820 WP_001138581.1.39822 WP_001138581.1.39829 WP_001138581.1.39870 WP_001138581.1.39938 WP_001138581.1.39961 WP_001138581.1.39966 WP_001138581.1.39970 WP_001138581.1.39992 WP_001138581.1.39998 WP_001138581.1.40016 WP_001138581.1.40088 WP_001138581.1.40113 WP_001138581.1.40147 WP_001138581.1.40192 WP_001138581.1.4020 WP_001138581.1.40206 WP_001138581.1.40212 WP_001138581.1.40218 WP_001138581.1.40234 WP_001138581.1.40238 WP_001138581.1.40298 WP_001138581.1.4030 WP_001138581.1.40317 WP_001138581.1.40319 WP_001138581.1.40335 WP_001138581.1.40382 WP_001138581.1.40389 WP_001138581.1.40391 WP_001138581.1.40403 WP_001138581.1.40445 WP_001138581.1.4049 WP_001138581.1.40502 WP_001138581.1.40509 WP_001138581.1.40524 WP_001138581.1.40548 WP_001138581.1.40549 WP_001138581.1.40596 WP_001138581.1.40599 WP_001138581.1.406 WP_001138581.1.40617 WP_001138581.1.40629 WP_001138581.1.40666 WP_001138581.1.40712 WP_001138581.1.40742 WP_001138581.1.40758 WP_001138581.1.40781 WP_001138581.1.40793 WP_001138581.1.40813 WP_001138581.1.40815 WP_001138581.1.4082 WP_001138581.1.40833 WP_001138581.1.40882 WP_001138581.1.40898 WP_001138581.1.40900 WP_001138581.1.40912 WP_001138581.1.40937 WP_001138581.1.40952 WP_001138581.1.40965 WP_001138581.1.4103 WP_001138581.1.41037 WP_001138581.1.41045 WP_001138581.1.41060 WP_001138581.1.41125 WP_001138581.1.41147 WP_001138581.1.41206 WP_001138581.1.4126 WP_001138581.1.41263 WP_001138581.1.41287 WP_001138581.1.41294 WP_001138581.1.41330 WP_001138581.1.41346 WP_001138581.1.41368 WP_001138581.1.41371 WP_001138581.1.41407 WP_001138581.1.41417 WP_001138581.1.4142 WP_001138581.1.41436 WP_001138581.1.41466 WP_001138581.1.41478 WP_001138581.1.41530 WP_001138581.1.41536 WP_001138581.1.41545 WP_001138581.1.41556 WP_001138581.1.41613 WP_001138581.1.41651 WP_001138581.1.41712 WP_001138581.1.4172 WP_001138581.1.41734 WP_001138581.1.41740 WP_001138581.1.41782 WP_001138581.1.41784 WP_001138581.1.41812 WP_001138581.1.41826 WP_001138581.1.41849 WP_001138581.1.41900 WP_001138581.1.41960 WP_001138581.1.42022 WP_001138581.1.42027 WP_001138581.1.42033 WP_001138581.1.42036 WP_001138581.1.42060 WP_001138581.1.42073 WP_001138581.1.42113 WP_001138581.1.4213 WP_001138581.1.42159 WP_001138581.1.42179 WP_001138581.1.42209 WP_001138581.1.42214 WP_001138581.1.42226 WP_001138581.1.42233 WP_001138581.1.42252 WP_001138581.1.42318 WP_001138581.1.42367 WP_001138581.1.42376 WP_001138581.1.42387 WP_001138581.1.4242 WP_001138581.1.42442 WP_001138581.1.42447 WP_001138581.1.42480 WP_001138581.1.4250 WP_001138581.1.42513 WP_001138581.1.42522 WP_001138581.1.42594 WP_001138581.1.4261 WP_001138581.1.42661 WP_001138581.1.42669 WP_001138581.1.42749 WP_001138581.1.42756 WP_001138581.1.42770 WP_001138581.1.42813 WP_001138581.1.4282 WP_001138581.1.42832 WP_001138581.1.42863 WP_001138581.1.42879 WP_001138581.1.42891 WP_001138581.1.4290 WP_001138581.1.42936 WP_001138581.1.42937 WP_001138581.1.42950 WP_001138581.1.42962 WP_001138581.1.42975 WP_001138581.1.42987 WP_001138581.1.42989 WP_001138581.1.43013 WP_001138581.1.43035 WP_001138581.1.4306 WP_001138581.1.43079 WP_001138581.1.43121 WP_001138581.1.4313 WP_001138581.1.43132 WP_001138581.1.43140 WP_001138581.1.43166 WP_001138581.1.43196 WP_001138581.1.43239 WP_001138581.1.43270 WP_001138581.1.43363 WP_001138581.1.43384 WP_001138581.1.43389 WP_001138581.1.43444 WP_001138581.1.43448 WP_001138581.1.43469 WP_001138581.1.43473 WP_001138581.1.43474 WP_001138581.1.43489 WP_001138581.1.43536 WP_001138581.1.43598 WP_001138581.1.43604 WP_001138581.1.43622 WP_001138581.1.43642 WP_001138581.1.43720 WP_001138581.1.43750 WP_001138581.1.43754 WP_001138581.1.43769 WP_001138581.1.43798 WP_001138581.1.43804 WP_001138581.1.43816 WP_001138581.1.43837 WP_001138581.1.43858 WP_001138581.1.43911 WP_001138581.1.43925 WP_001138581.1.43939 WP_001138581.1.43989 WP_001138581.1.44020 WP_001138581.1.44040 WP_001138581.1.44088 WP_001138581.1.44096 WP_001138581.1.44100 WP_001138581.1.44115 WP_001138581.1.44125 WP_001138581.1.4415 WP_001138581.1.44162 WP_001138581.1.44165 WP_001138581.1.44166 WP_001138581.1.44203 WP_001138581.1.44211 WP_001138581.1.44238 WP_001138581.1.44273 WP_001138581.1.44292 WP_001138581.1.44324 WP_001138581.1.44365 WP_001138581.1.44389 WP_001138581.1.44458 WP_001138581.1.44488 WP_001138581.1.44524 WP_001138581.1.44558 WP_001138581.1.44561 WP_001138581.1.44570 WP_001138581.1.44587 WP_001138581.1.44608 WP_001138581.1.44610 WP_001138581.1.44724 WP_001138581.1.44733 WP_001138581.1.44756 WP_001138581.1.44841 WP_001138581.1.44849 WP_001138581.1.44854 WP_001138581.1.44906 WP_001138581.1.44923 WP_001138581.1.44954 WP_001138581.1.44960 WP_001138581.1.44961 WP_001138581.1.44970 WP_001138581.1.44980 WP_001138581.1.45020 WP_001138581.1.45025 WP_001138581.1.45028 WP_001138581.1.45076 WP_001138581.1.45104 WP_001138581.1.45116 WP_001138581.1.45153 WP_001138581.1.4516 WP_001138581.1.45195 WP_001138581.1.45208 WP_001138581.1.45246 WP_001138581.1.45293 WP_001138581.1.45301 WP_001138581.1.45313 WP_001138581.1.45329 WP_001138581.1.45359 WP_001138581.1.45404 WP_001138581.1.45440 WP_001138581.1.45444 WP_001138581.1.4549 WP_001138581.1.45575 WP_001138581.1.45581 WP_001138581.1.45595 WP_001138581.1.45600 WP_001138581.1.45707 WP_001138581.1.45718 WP_001138581.1.4574 WP_001138581.1.45741 WP_001138581.1.45752 WP_001138581.1.45840 WP_001138581.1.45841 WP_001138581.1.45846 WP_001138581.1.45865 WP_001138581.1.45901 WP_001138581.1.4593 WP_001138581.1.45930 WP_001138581.1.45933 WP_001138581.1.45941 WP_001138581.1.45945 WP_001138581.1.45968 WP_001138581.1.4600 WP_001138581.1.46026 WP_001138581.1.46027 WP_001138581.1.46039 WP_001138581.1.46048 WP_001138581.1.46049 WP_001138581.1.46097 WP_001138581.1.46115 WP_001138581.1.46186 WP_001138581.1.4619 WP_001138581.1.46197 WP_001138581.1.46213 WP_001138581.1.46239 WP_001138581.1.46257 WP_001138581.1.46282 WP_001138581.1.46283 WP_001138581.1.46325 WP_001138581.1.46369 WP_001138581.1.46414 WP_001138581.1.46441 WP_001138581.1.46451 WP_001138581.1.4646 WP_001138581.1.4647 WP_001138581.1.46503 WP_001138581.1.46526 WP_001138581.1.46552 WP_001138581.1.46555 WP_001138581.1.46573 WP_001138581.1.46582 WP_001138581.1.46597 WP_001138581.1.46602 WP_001138581.1.46611 WP_001138581.1.46626 WP_001138581.1.46643 WP_001138581.1.4670 WP_001138581.1.46743 WP_001138581.1.46802 WP_001138581.1.46810 WP_001138581.1.46820 WP_001138581.1.46821 WP_001138581.1.46832 WP_001138581.1.46876 WP_001138581.1.46882 WP_001138581.1.46898 WP_001138581.1.46909 WP_001138581.1.4691 WP_001138581.1.46912 WP_001138581.1.46913 WP_001138581.1.46932 WP_001138581.1.47028 WP_001138581.1.47034 WP_001138581.1.47038 WP_001138581.1.47048 WP_001138581.1.47063 WP_001138581.1.4708 WP_001138581.1.47140 WP_001138581.1.47186 WP_001138581.1.4722 WP_001138581.1.47224 WP_001138581.1.4723 WP_001138581.1.47246 WP_001138581.1.47280 WP_001138581.1.47307 WP_001138581.1.47319 WP_001138581.1.47322 WP_001138581.1.47370 WP_001138581.1.47386 WP_001138581.1.47398 WP_001138581.1.47401 WP_001138581.1.47411 WP_001138581.1.47414 WP_001138581.1.47477 WP_001138581.1.47496 WP_001138581.1.47529 WP_001138581.1.47634 WP_001138581.1.47646 WP_001138581.1.47673 WP_001138581.1.4772 WP_001138581.1.47734 WP_001138581.1.47740 WP_001138581.1.47744 WP_001138581.1.47761 WP_001138581.1.47764 WP_001138581.1.47765 WP_001138581.1.47770 WP_001138581.1.47784 WP_001138581.1.47820 WP_001138581.1.47827 WP_001138581.1.4785 WP_001138581.1.47884 WP_001138581.1.47954 WP_001138581.1.47962 WP_001138581.1.47976 WP_001138581.1.47994 WP_001138581.1.48040 WP_001138581.1.48048 WP_001138581.1.48065 WP_001138581.1.48073 WP_001138581.1.48077 WP_001138581.1.48080 WP_001138581.1.48096 WP_001138581.1.48111 WP_001138581.1.4812 WP_001138581.1.48176 WP_001138581.1.48194 WP_001138581.1.48203 WP_001138581.1.48226 WP_001138581.1.48258 WP_001138581.1.48290 WP_001138581.1.48353 WP_001138581.1.48355 WP_001138581.1.48371 WP_001138581.1.48433 WP_001138581.1.48477 WP_001138581.1.48480 WP_001138581.1.48483 WP_001138581.1.48505 WP_001138581.1.48522 WP_001138581.1.48571 WP_001138581.1.486 WP_001138581.1.48615 WP_001138581.1.48678 WP_001138581.1.48697 WP_001138581.1.4871 WP_001138581.1.48712 WP_001138581.1.48771 WP_001138581.1.48792 WP_001138581.1.48801 WP_001138581.1.48806 WP_001138581.1.48847 WP_001138581.1.48860 WP_001138581.1.48901 WP_001138581.1.48921 WP_001138581.1.48926 WP_001138581.1.48928 WP_001138581.1.48953 WP_001138581.1.48954 WP_001138581.1.48970 WP_001138581.1.48974 WP_001138581.1.49009 WP_001138581.1.49107 WP_001138581.1.49190 WP_001138581.1.49229 WP_001138581.1.49236 WP_001138581.1.4931 WP_001138581.1.49332 WP_001138581.1.49336 WP_001138581.1.49363 WP_001138581.1.49401 WP_001138581.1.49459 WP_001138581.1.49464 WP_001138581.1.49481 WP_001138581.1.49482 WP_001138581.1.4949 WP_001138581.1.49496 WP_001138581.1.49531 WP_001138581.1.49537 WP_001138581.1.49546 WP_001138581.1.49558 WP_001138581.1.49567 WP_001138581.1.49599 WP_001138581.1.49645 WP_001138581.1.49655 WP_001138581.1.49661 WP_001138581.1.497 WP_001138581.1.49722 WP_001138581.1.49733 WP_001138581.1.49740 WP_001138581.1.49768 WP_001138581.1.49771 WP_001138581.1.49856 WP_001138581.1.49861 WP_001138581.1.49879 WP_001138581.1.49883 WP_001138581.1.49900 WP_001138581.1.49950 WP_001138581.1.50006 WP_001138581.1.50008 WP_001138581.1.5003 WP_001138581.1.50036 WP_001138581.1.50078 WP_001138581.1.50110 WP_001138581.1.50113 WP_001138581.1.50119 WP_001138581.1.5017 WP_001138581.1.50182 WP_001138581.1.50207 WP_001138581.1.50258 WP_001138581.1.50262 WP_001138581.1.50266 WP_001138581.1.50269 WP_001138581.1.50345 WP_001138581.1.50353 WP_001138581.1.50358 WP_001138581.1.50361 WP_001138581.1.50366 WP_001138581.1.5037 WP_001138581.1.50380 WP_001138581.1.50412 WP_001138581.1.50452 WP_001138581.1.50549 WP_001138581.1.5056 WP_001138581.1.50564 WP_001138581.1.50579 WP_001138581.1.50715 WP_001138581.1.50717 WP_001138581.1.50762 WP_001138581.1.50925 WP_001138581.1.5095 WP_001138581.1.50986 WP_001138581.1.50996 WP_001138581.1.51042 WP_001138581.1.51109 WP_001138581.1.51154 WP_001138581.1.51171 WP_001138581.1.51172 WP_001138581.1.51248 WP_001138581.1.51255 WP_001138581.1.51278 WP_001138581.1.5128 WP_001138581.1.51325 WP_001138581.1.51380 WP_001138581.1.51405 WP_001138581.1.51425 WP_001138581.1.51427 WP_001138581.1.51430 WP_001138581.1.51441 WP_001138581.1.5146 WP_001138581.1.51462 WP_001138581.1.51490 WP_001138581.1.51495 WP_001138581.1.51505 WP_001138581.1.51539 WP_001138581.1.51548 WP_001138581.1.51552 WP_001138581.1.5157 WP_001138581.1.51607 WP_001138581.1.51643 WP_001138581.1.51693 WP_001138581.1.51707 WP_001138581.1.5172 WP_001138581.1.51784 WP_001138581.1.51834 WP_001138581.1.51839 WP_001138581.1.51873 WP_001138581.1.51899 WP_001138581.1.51968 WP_001138581.1.51985 WP_001138581.1.51988 WP_001138581.1.51999 WP_001138581.1.52002 WP_001138581.1.52020 WP_001138581.1.52039 WP_001138581.1.52062 WP_001138581.1.52076 WP_001138581.1.52127 WP_001138581.1.52135 WP_001138581.1.5217 WP_001138581.1.52171 WP_001138581.1.52186 WP_001138581.1.52200 WP_001138581.1.52211 WP_001138581.1.52243 WP_001138581.1.52249 WP_001138581.1.5227 WP_001138581.1.52305 WP_001138581.1.52333 WP_001138581.1.52378 WP_001138581.1.5239 WP_001138581.1.52419 WP_001138581.1.52421 WP_001138581.1.52492 WP_001138581.1.52496 WP_001138581.1.52524 WP_001138581.1.52543 WP_001138581.1.52544 WP_001138581.1.52558 WP_001138581.1.52612 WP_001138581.1.52662 WP_001138581.1.52710 WP_001138581.1.5272 WP_001138581.1.52735 WP_001138581.1.52774 WP_001138581.1.52780 WP_001138581.1.52801 WP_001138581.1.52846 WP_001138581.1.52852 WP_001138581.1.52853 WP_001138581.1.52883 WP_001138581.1.52895 WP_001138581.1.52908 WP_001138581.1.52933 WP_001138581.1.52995 WP_001138581.1.53012 WP_001138581.1.53020 WP_001138581.1.53065 WP_001138581.1.53084 WP_001138581.1.53095 WP_001138581.1.53110 WP_001138581.1.53155 WP_001138581.1.53181 WP_001138581.1.53211 WP_001138581.1.53223 WP_001138581.1.53228 WP_001138581.1.53238 WP_001138581.1.53244 WP_001138581.1.53252 WP_001138581.1.53270 WP_001138581.1.53356 WP_001138581.1.53377 WP_001138581.1.53401 WP_001138581.1.53428 WP_001138581.1.53482 WP_001138581.1.53505 WP_001138581.1.53545 WP_001138581.1.53592 WP_001138581.1.5362 WP_001138581.1.53642 WP_001138581.1.53706 WP_001138581.1.53809 WP_001138581.1.53863 WP_001138581.1.53866 WP_001138581.1.53931 WP_001138581.1.53966 WP_001138581.1.53972 WP_001138581.1.53978 WP_001138581.1.53994 WP_001138581.1.54002 WP_001138581.1.54013 WP_001138581.1.54024 WP_001138581.1.54028 WP_001138581.1.54072 WP_001138581.1.54144 WP_001138581.1.54169 WP_001138581.1.54185 WP_001138581.1.54213 WP_001138581.1.54263 WP_001138581.1.54307 WP_001138581.1.54344 WP_001138581.1.54359 WP_001138581.1.5441 WP_001138581.1.54454 WP_001138581.1.54476 WP_001138581.1.54507 WP_001138581.1.54591 WP_001138581.1.5460 WP_001138581.1.54602 WP_001138581.1.54605 WP_001138581.1.5461 WP_001138581.1.54617 WP_001138581.1.54620 WP_001138581.1.54625 WP_001138581.1.54638 WP_001138581.1.5467 WP_001138581.1.54688 WP_001138581.1.5470 WP_001138581.1.54708 WP_001138581.1.54725 WP_001138581.1.54729 WP_001138581.1.54769 WP_001138581.1.5479 WP_001138581.1.54829 WP_001138581.1.5486 WP_001138581.1.54883 WP_001138581.1.54918 WP_001138581.1.54927 WP_001138581.1.54941 WP_001138581.1.54981 WP_001138581.1.54991 WP_001138581.1.55003 WP_001138581.1.55009 WP_001138581.1.55041 WP_001138581.1.55115 WP_001138581.1.55123 WP_001138581.1.55134 WP_001138581.1.55144 WP_001138581.1.5520 WP_001138581.1.55203 WP_001138581.1.55218 WP_001138581.1.55222 WP_001138581.1.55286 WP_001138581.1.55338 WP_001138581.1.55342 WP_001138581.1.55357 WP_001138581.1.55381 WP_001138581.1.55424 WP_001138581.1.55466 WP_001138581.1.55489 WP_001138581.1.55492 WP_001138581.1.55507 WP_001138581.1.55529 WP_001138581.1.55551 WP_001138581.1.55552 WP_001138581.1.55560 WP_001138581.1.55571 WP_001138581.1.55574 WP_001138581.1.55597 WP_001138581.1.55608 WP_001138581.1.55629 WP_001138581.1.55676 WP_001138581.1.5570 WP_001138581.1.55757 WP_001138581.1.55820 WP_001138581.1.55825 WP_001138581.1.55838 WP_001138581.1.55844 WP_001138581.1.55868 WP_001138581.1.55892 WP_001138581.1.55897 WP_001138581.1.56072 WP_001138581.1.561 WP_001138581.1.5614 WP_001138581.1.56151 WP_001138581.1.5616 WP_001138581.1.56164 WP_001138581.1.56177 WP_001138581.1.56197 WP_001138581.1.56216 WP_001138581.1.56231 WP_001138581.1.56285 WP_001138581.1.56371 WP_001138581.1.5639 WP_001138581.1.56392 WP_001138581.1.56399 WP_001138581.1.56436 WP_001138581.1.56439 WP_001138581.1.56481 WP_001138581.1.56489 WP_001138581.1.56491 WP_001138581.1.56513 WP_001138581.1.56528 WP_001138581.1.56543 WP_001138581.1.56554 WP_001138581.1.56571 WP_001138581.1.56586 WP_001138581.1.56665 WP_001138581.1.56680 WP_001138581.1.56704 WP_001138581.1.56721 WP_001138581.1.56789 WP_001138581.1.56799 WP_001138581.1.56846 WP_001138581.1.56871 WP_001138581.1.56882 WP_001138581.1.56932 WP_001138581.1.56934 WP_001138581.1.56978 WP_001138581.1.56980 WP_001138581.1.57032 WP_001138581.1.57051 WP_001138581.1.57068 WP_001138581.1.57071 WP_001138581.1.57124 WP_001138581.1.57180 WP_001138581.1.57181 WP_001138581.1.57197 WP_001138581.1.57222 WP_001138581.1.57280 WP_001138581.1.57401 WP_001138581.1.57403 WP_001138581.1.57410 WP_001138581.1.57414 WP_001138581.1.57432 WP_001138581.1.57453 WP_001138581.1.57466 WP_001138581.1.5748 WP_001138581.1.57487 WP_001138581.1.57538 WP_001138581.1.57558 WP_001138581.1.57610 WP_001138581.1.57638 WP_001138581.1.5764 WP_001138581.1.57646 WP_001138581.1.57659 WP_001138581.1.57719 WP_001138581.1.57738 WP_001138581.1.57812 WP_001138581.1.57836 WP_001138581.1.57846 WP_001138581.1.5786 WP_001138581.1.57904 WP_001138581.1.57920 WP_001138581.1.58045 WP_001138581.1.58048 WP_001138581.1.58057 WP_001138581.1.58080 WP_001138581.1.58143 WP_001138581.1.58163 WP_001138581.1.58172 WP_001138581.1.58226 WP_001138581.1.58232 WP_001138581.1.58238 WP_001138581.1.58267 WP_001138581.1.58289 WP_001138581.1.58371 WP_001138581.1.584 WP_001138581.1.58401 WP_001138581.1.5842 WP_001138581.1.58420 WP_001138581.1.58423 WP_001138581.1.58429 WP_001138581.1.58440 WP_001138581.1.58445 WP_001138581.1.58475 WP_001138581.1.5852 WP_001138581.1.58547 WP_001138581.1.58572 WP_001138581.1.58582 WP_001138581.1.58622 WP_001138581.1.58707 WP_001138581.1.58723 WP_001138581.1.58867 WP_001138581.1.58870 WP_001138581.1.58940 WP_001138581.1.58951 WP_001138581.1.58958 WP_001138581.1.58976 WP_001138581.1.58977 WP_001138581.1.58983 WP_001138581.1.59024 WP_001138581.1.59026 WP_001138581.1.59035 WP_001138581.1.59038 WP_001138581.1.5906 WP_001138581.1.59083 WP_001138581.1.59119 WP_001138581.1.59190 WP_001138581.1.59199 WP_001138581.1.59293 WP_001138581.1.59302 WP_001138581.1.59306 WP_001138581.1.59359 WP_001138581.1.59374 WP_001138581.1.59407 WP_001138581.1.59413 WP_001138581.1.59423 WP_001138581.1.59470 WP_001138581.1.59491 WP_001138581.1.59513 WP_001138581.1.59533 WP_001138581.1.59553 WP_001138581.1.59590 WP_001138581.1.59615 WP_001138581.1.59638 WP_001138581.1.5965 WP_001138581.1.59679 WP_001138581.1.59699 WP_001138581.1.59730 WP_001138581.1.59733 WP_001138581.1.59737 WP_001138581.1.59756 WP_001138581.1.59781 WP_001138581.1.59782 WP_001138581.1.59823 WP_001138581.1.59836 WP_001138581.1.59838 WP_001138581.1.59877 WP_001138581.1.59905 WP_001138581.1.59912 WP_001138581.1.59931 WP_001138581.1.59932 WP_001138581.1.59959 WP_001138581.1.59998 WP_001138581.1.6002 WP_001138581.1.60031 WP_001138581.1.60042 WP_001138581.1.60043 WP_001138581.1.60067 WP_001138581.1.60070 WP_001138581.1.60095 WP_001138581.1.60117 WP_001138581.1.6013 WP_001138581.1.60151 WP_001138581.1.60228 WP_001138581.1.60304 WP_001138581.1.60343 WP_001138581.1.60374 WP_001138581.1.60457 WP_001138581.1.60461 WP_001138581.1.60477 WP_001138581.1.60491 WP_001138581.1.60498 WP_001138581.1.60550 WP_001138581.1.60576 WP_001138581.1.60606 WP_001138581.1.6061 WP_001138581.1.60613 WP_001138581.1.6064 WP_001138581.1.60647 WP_001138581.1.6066 WP_001138581.1.60698 WP_001138581.1.60717 WP_001138581.1.60732 WP_001138581.1.60744 WP_001138581.1.60761 WP_001138581.1.60764 WP_001138581.1.60805 WP_001138581.1.60832 WP_001138581.1.60872 WP_001138581.1.60895 WP_001138581.1.60927 WP_001138581.1.60935 WP_001138581.1.61035 WP_001138581.1.61039 WP_001138581.1.61046 WP_001138581.1.6106 WP_001138581.1.61096 WP_001138581.1.61099 WP_001138581.1.61108 WP_001138581.1.61112 WP_001138581.1.61170 WP_001138581.1.61181 WP_001138581.1.61183 WP_001138581.1.61186 WP_001138581.1.61241 WP_001138581.1.61253 WP_001138581.1.61292 WP_001138581.1.61398 WP_001138581.1.61505 WP_001138581.1.61517 WP_001138581.1.61551 WP_001138581.1.61608 WP_001138581.1.61623 WP_001138581.1.61636 WP_001138581.1.61663 WP_001138581.1.61772 WP_001138581.1.61779 WP_001138581.1.618 WP_001138581.1.61806 WP_001138581.1.61822 WP_001138581.1.61858 WP_001138581.1.61874 WP_001138581.1.61926 WP_001138581.1.61948 WP_001138581.1.61949 WP_001138581.1.62041 WP_001138581.1.62099 WP_001138581.1.6212 WP_001138581.1.62135 WP_001138581.1.62157 WP_001138581.1.62182 WP_001138581.1.62290 WP_001138581.1.62296 WP_001138581.1.62337 WP_001138581.1.62447 WP_001138581.1.62460 WP_001138581.1.62480 WP_001138581.1.62487 WP_001138581.1.62514 WP_001138581.1.6261 WP_001138581.1.62612 WP_001138581.1.62642 WP_001138581.1.62646 WP_001138581.1.62668 WP_001138581.1.62675 WP_001138581.1.62735 WP_001138581.1.62750 WP_001138581.1.62769 WP_001138581.1.62787 WP_001138581.1.62812 WP_001138581.1.62818 WP_001138581.1.62840 WP_001138581.1.62843 WP_001138581.1.62850 WP_001138581.1.62888 WP_001138581.1.62919 WP_001138581.1.6293 WP_001138581.1.62931 WP_001138581.1.62959 WP_001138581.1.62973 WP_001138581.1.62989 WP_001138581.1.63167 WP_001138581.1.63177 WP_001138581.1.63189 WP_001138581.1.6323 WP_001138581.1.63287 WP_001138581.1.6331 WP_001138581.1.6337 WP_001138581.1.63370 WP_001138581.1.63374 WP_001138581.1.63393 WP_001138581.1.63445 WP_001138581.1.63453 WP_001138581.1.63466 WP_001138581.1.63467 WP_001138581.1.63470 WP_001138581.1.63484 WP_001138581.1.63491 WP_001138581.1.63536 WP_001138581.1.63563 WP_001138581.1.63586 WP_001138581.1.63615 WP_001138581.1.6364 WP_001138581.1.63703 WP_001138581.1.63721 WP_001138581.1.63746 WP_001138581.1.63821 WP_001138581.1.63872 WP_001138581.1.63957 WP_001138581.1.63964 WP_001138581.1.64008 WP_001138581.1.64014 WP_001138581.1.64040 WP_001138581.1.64080 WP_001138581.1.64086 WP_001138581.1.64110 WP_001138581.1.64150 WP_001138581.1.64161 WP_001138581.1.64175 WP_001138581.1.64286 WP_001138581.1.6431 WP_001138581.1.64321 WP_001138581.1.64337 WP_001138581.1.64353 WP_001138581.1.64371 WP_001138581.1.64380 WP_001138581.1.64391 WP_001138581.1.6441 WP_001138581.1.64438 WP_001138581.1.64448 WP_001138581.1.6445 WP_001138581.1.64458 WP_001138581.1.64528 WP_001138581.1.64621 WP_001138581.1.64657 WP_001138581.1.64693 WP_001138581.1.647 WP_001138581.1.64784 WP_001138581.1.64789 WP_001138581.1.64881 WP_001138581.1.64912 WP_001138581.1.64926 WP_001138581.1.64946 WP_001138581.1.64970 WP_001138581.1.6499 WP_001138581.1.64990 WP_001138581.1.65035 WP_001138581.1.65084 WP_001138581.1.65097 WP_001138581.1.651 WP_001138581.1.6511 WP_001138581.1.65118 WP_001138581.1.65151 WP_001138581.1.65155 WP_001138581.1.65179 WP_001138581.1.65194 WP_001138581.1.65206 WP_001138581.1.65256 WP_001138581.1.65271 WP_001138581.1.65305 WP_001138581.1.65353 WP_001138581.1.65364 WP_001138581.1.6537 WP_001138581.1.65370 WP_001138581.1.65372 WP_001138581.1.65408 WP_001138581.1.65413 WP_001138581.1.65415 WP_001138581.1.65531 WP_001138581.1.65546 WP_001138581.1.65581 WP_001138581.1.65596 WP_001138581.1.6563 WP_001138581.1.65672 WP_001138581.1.65708 WP_001138581.1.65762 WP_001138581.1.6587 WP_001138581.1.65875 WP_001138581.1.65898 WP_001138581.1.65912 WP_001138581.1.65961 WP_001138581.1.65963 WP_001138581.1.65978 WP_001138581.1.65988 WP_001138581.1.66001 WP_001138581.1.66033 WP_001138581.1.6604 WP_001138581.1.66050 WP_001138581.1.6609 WP_001138581.1.66094 WP_001138581.1.66100 WP_001138581.1.66104 WP_001138581.1.66105 WP_001138581.1.66121 WP_001138581.1.66127 WP_001138581.1.66181 WP_001138581.1.66197 WP_001138581.1.66251 WP_001138581.1.66280 WP_001138581.1.6635 WP_001138581.1.66387 WP_001138581.1.66389 WP_001138581.1.66395 WP_001138581.1.66412 WP_001138581.1.66501 WP_001138581.1.66531 WP_001138581.1.6654 WP_001138581.1.66550 WP_001138581.1.66559 WP_001138581.1.66566 WP_001138581.1.66579 WP_001138581.1.6665 WP_001138581.1.66700 WP_001138581.1.66719 WP_001138581.1.66758 WP_001138581.1.66783 WP_001138581.1.66795 WP_001138581.1.66849 WP_001138581.1.66873 WP_001138581.1.66922 WP_001138581.1.66926 WP_001138581.1.66933 WP_001138581.1.66948 WP_001138581.1.67021 WP_001138581.1.67022 WP_001138581.1.67026 WP_001138581.1.67073 WP_001138581.1.67120 WP_001138581.1.67136 WP_001138581.1.67150 WP_001138581.1.67200 WP_001138581.1.67214 WP_001138581.1.6723 WP_001138581.1.6735 WP_001138581.1.67415 WP_001138581.1.67446 WP_001138581.1.67452 WP_001138581.1.67454 WP_001138581.1.67468 WP_001138581.1.67533 WP_001138581.1.67538 WP_001138581.1.67553 WP_001138581.1.67660 WP_001138581.1.67663 WP_001138581.1.67676 WP_001138581.1.6769 WP_001138581.1.67724 WP_001138581.1.67726 WP_001138581.1.67753 WP_001138581.1.67775 WP_001138581.1.67780 WP_001138581.1.67786 WP_001138581.1.67787 WP_001138581.1.67788 WP_001138581.1.678 WP_001138581.1.67810 WP_001138581.1.67853 WP_001138581.1.67861 WP_001138581.1.67975 WP_001138581.1.67990 WP_001138581.1.68008 WP_001138581.1.6802 WP_001138581.1.68025 WP_001138581.1.6803 WP_001138581.1.68079 WP_001138581.1.68096 WP_001138581.1.6814 WP_001138581.1.68170 WP_001138581.1.682 WP_001138581.1.68215 WP_001138581.1.68241 WP_001138581.1.68255 WP_001138581.1.68283 WP_001138581.1.68300 WP_001138581.1.68336 WP_001138581.1.68341 WP_001138581.1.68396 WP_001138581.1.68411 WP_001138581.1.68442 WP_001138581.1.68493 WP_001138581.1.68523 WP_001138581.1.68534 WP_001138581.1.68566 WP_001138581.1.68609 WP_001138581.1.68673 WP_001138581.1.68678 WP_001138581.1.68697 WP_001138581.1.68711 WP_001138581.1.68751 WP_001138581.1.6877 WP_001138581.1.68797 WP_001138581.1.6880 WP_001138581.1.68801 WP_001138581.1.6887 WP_001138581.1.68915 WP_001138581.1.68936 WP_001138581.1.68989 WP_001138581.1.69054 WP_001138581.1.69098 WP_001138581.1.69144 WP_001138581.1.6916 WP_001138581.1.6923 WP_001138581.1.69247 WP_001138581.1.69261 WP_001138581.1.69303 WP_001138581.1.69305 WP_001138581.1.69350 WP_001138581.1.69351 WP_001138581.1.69390 WP_001138581.1.694 WP_001138581.1.6945 WP_001138581.1.69473 WP_001138581.1.69551 WP_001138581.1.69583 WP_001138581.1.69589 WP_001138581.1.69646 WP_001138581.1.69689 WP_001138581.1.69780 WP_001138581.1.69803 WP_001138581.1.69810 WP_001138581.1.69818 WP_001138581.1.69887 WP_001138581.1.69896 WP_001138581.1.6993 WP_001138581.1.69972 WP_001138581.1.70063 WP_001138581.1.70123 WP_001138581.1.70125 WP_001138581.1.70149 WP_001138581.1.70407 WP_001138581.1.70414 WP_001138581.1.70492 WP_001138581.1.70517 WP_001138581.1.70539 WP_001138581.1.70576 WP_001138581.1.70578 WP_001138581.1.70582 WP_001138581.1.70619 WP_001138581.1.70628 WP_001138581.1.70694 WP_001138581.1.70713 WP_001138581.1.70723 WP_001138581.1.70745 WP_001138581.1.70767 WP_001138581.1.70787 WP_001138581.1.70794 WP_001138581.1.70803 WP_001138581.1.70880 WP_001138581.1.7090 WP_001138581.1.70900 WP_001138581.1.70952 WP_001138581.1.70967 WP_001138581.1.71003 WP_001138581.1.71024 WP_001138581.1.71062 WP_001138581.1.71099 WP_001138581.1.71109 WP_001138581.1.71113 WP_001138581.1.71159 WP_001138581.1.71162 WP_001138581.1.71199 WP_001138581.1.71205 WP_001138581.1.71221 WP_001138581.1.71225 WP_001138581.1.71226 WP_001138581.1.71229 WP_001138581.1.71269 WP_001138581.1.71285 WP_001138581.1.71312 WP_001138581.1.71315 WP_001138581.1.71323 WP_001138581.1.71327 WP_001138581.1.71397 WP_001138581.1.71423 WP_001138581.1.71448 WP_001138581.1.71480 WP_001138581.1.71522 WP_001138581.1.71537 WP_001138581.1.71540 WP_001138581.1.71603 WP_001138581.1.71632 WP_001138581.1.71680 WP_001138581.1.71690 WP_001138581.1.71757 WP_001138581.1.71767 WP_001138581.1.71783 WP_001138581.1.71837 WP_001138581.1.71840 WP_001138581.1.71856 WP_001138581.1.71874 WP_001138581.1.71938 WP_001138581.1.71940 WP_001138581.1.71944 WP_001138581.1.71975 WP_001138581.1.71987 WP_001138581.1.71993 WP_001138581.1.72013 WP_001138581.1.72016 WP_001138581.1.72021 WP_001138581.1.7205 WP_001138581.1.72053 WP_001138581.1.72090 WP_001138581.1.7210 WP_001138581.1.72125 WP_001138581.1.72141 WP_001138581.1.72153 WP_001138581.1.72157 WP_001138581.1.72180 WP_001138581.1.72184 WP_001138581.1.72237 WP_001138581.1.72261 WP_001138581.1.72270 WP_001138581.1.72290 WP_001138581.1.72322 WP_001138581.1.72337 WP_001138581.1.72397 WP_001138581.1.72427 WP_001138581.1.72431 WP_001138581.1.72485 WP_001138581.1.72493 WP_001138581.1.72511 WP_001138581.1.72521 WP_001138581.1.72535 WP_001138581.1.72537 WP_001138581.1.72544 WP_001138581.1.72582 WP_001138581.1.72608 WP_001138581.1.72614 WP_001138581.1.72616 WP_001138581.1.72641 WP_001138581.1.72643 WP_001138581.1.72652 WP_001138581.1.72663 WP_001138581.1.72694 WP_001138581.1.72745 WP_001138581.1.72747 WP_001138581.1.72758 WP_001138581.1.72764 WP_001138581.1.72860 WP_001138581.1.72869 WP_001138581.1.7291 WP_001138581.1.72910 WP_001138581.1.72913 WP_001138581.1.72947 WP_001138581.1.73010 WP_001138581.1.73032 WP_001138581.1.73072 WP_001138581.1.73075 WP_001138581.1.73085 WP_001138581.1.73126 WP_001138581.1.73197 WP_001138581.1.73217 WP_001138581.1.73239 WP_001138581.1.73249 WP_001138581.1.73251 WP_001138581.1.73257 WP_001138581.1.73292 WP_001138581.1.73295 WP_001138581.1.73326 WP_001138581.1.73340 WP_001138581.1.73343 WP_001138581.1.73385 WP_001138581.1.73428 WP_001138581.1.73468 WP_001138581.1.7349 WP_001138581.1.73524 WP_001138581.1.73565 WP_001138581.1.73604 WP_001138581.1.73626 WP_001138581.1.73663 WP_001138581.1.73700 WP_001138581.1.73717 WP_001138581.1.7376 WP_001138581.1.73785 WP_001138581.1.73801 WP_001138581.1.73807 WP_001138581.1.73827 WP_001138581.1.73835 WP_001138581.1.73844 WP_001138581.1.73859 WP_001138581.1.73882 WP_001138581.1.73897 WP_001138581.1.7392 WP_001138581.1.73934 WP_001138581.1.73942 WP_001138581.1.73968 WP_001138581.1.73992 WP_001138581.1.73995 WP_001138581.1.73996 WP_001138581.1.74051 WP_001138581.1.7411 WP_001138581.1.74184 WP_001138581.1.7424 WP_001138581.1.7425 WP_001138581.1.74251 WP_001138581.1.7429 WP_001138581.1.74309 WP_001138581.1.74365 WP_001138581.1.74423 WP_001138581.1.74444 WP_001138581.1.74445 WP_001138581.1.7446 WP_001138581.1.74491 WP_001138581.1.74513 WP_001138581.1.74520 WP_001138581.1.74521 WP_001138581.1.74528 WP_001138581.1.74536 WP_001138581.1.74557 WP_001138581.1.7461 WP_001138581.1.74624 WP_001138581.1.74625 WP_001138581.1.74652 WP_001138581.1.74688 WP_001138581.1.74691 WP_001138581.1.74713 WP_001138581.1.7475 WP_001138581.1.74752 WP_001138581.1.74811 WP_001138581.1.74828 WP_001138581.1.74844 WP_001138581.1.74885 WP_001138581.1.74895 WP_001138581.1.74904 WP_001138581.1.74962 WP_001138581.1.74998 WP_001138581.1.75029 WP_001138581.1.75030 WP_001138581.1.75050 WP_001138581.1.75112 WP_001138581.1.75139 WP_001138581.1.75164 WP_001138581.1.75209 WP_001138581.1.75243 WP_001138581.1.75248 WP_001138581.1.75254 WP_001138581.1.75270 WP_001138581.1.75272 WP_001138581.1.7536 WP_001138581.1.75360 WP_001138581.1.75367 WP_001138581.1.75382 WP_001138581.1.7539 WP_001138581.1.75428 WP_001138581.1.75465 WP_001138581.1.75491 WP_001138581.1.75507 WP_001138581.1.75515 WP_001138581.1.75529 WP_001138581.1.75536 WP_001138581.1.75537 WP_001138581.1.75577 WP_001138581.1.75594 WP_001138581.1.75629 WP_001138581.1.75644 WP_001138581.1.75653 WP_001138581.1.75672 WP_001138581.1.75676 WP_001138581.1.75679 WP_001138581.1.75694 WP_001138581.1.75699 WP_001138581.1.75735 WP_001138581.1.75758 WP_001138581.1.75767 WP_001138581.1.7583 WP_001138581.1.75983 WP_001138581.1.75989 WP_001138581.1.75995 WP_001138581.1.75999 WP_001138581.1.7603 WP_001138581.1.76036 WP_001138581.1.76039 WP_001138581.1.76054 WP_001138581.1.7608 WP_001138581.1.76087 WP_001138581.1.76103 WP_001138581.1.76129 WP_001138581.1.76152 WP_001138581.1.76184 WP_001138581.1.76189 WP_001138581.1.76196 WP_001138581.1.76211 WP_001138581.1.76312 WP_001138581.1.76387 WP_001138581.1.76390 WP_001138581.1.76407 WP_001138581.1.76446 WP_001138581.1.76448 WP_001138581.1.76462 WP_001138581.1.76477 WP_001138581.1.76547 WP_001138581.1.76562 WP_001138581.1.76595 WP_001138581.1.7661 WP_001138581.1.76619 WP_001138581.1.76697 WP_001138581.1.76701 WP_001138581.1.76707 WP_001138581.1.76712 WP_001138581.1.76815 WP_001138581.1.76827 WP_001138581.1.76840 WP_001138581.1.7689 WP_001138581.1.76918 WP_001138581.1.76948 WP_001138581.1.76965 WP_001138581.1.76966 WP_001138581.1.7699 WP_001138581.1.77015 WP_001138581.1.77099 WP_001138581.1.77128 WP_001138581.1.77147 WP_001138581.1.77175 WP_001138581.1.77214 WP_001138581.1.77239 WP_001138581.1.77255 WP_001138581.1.77258 WP_001138581.1.77275 WP_001138581.1.7728 WP_001138581.1.77284 WP_001138581.1.7731 WP_001138581.1.77358 WP_001138581.1.77392 WP_001138581.1.77452 WP_001138581.1.77470 WP_001138581.1.77471 WP_001138581.1.77477 WP_001138581.1.77495 WP_001138581.1.77503 WP_001138581.1.77551 WP_001138581.1.77595 WP_001138581.1.77608 WP_001138581.1.77626 WP_001138581.1.77636 WP_001138581.1.77644 WP_001138581.1.77648 WP_001138581.1.77707 WP_001138581.1.77760 WP_001138581.1.77767 WP_001138581.1.77768 WP_001138581.1.77876 WP_001138581.1.77949 WP_001138581.1.77961 WP_001138581.1.77979 WP_001138581.1.7799 WP_001138581.1.77999 WP_001138581.1.78000 WP_001138581.1.78063 WP_001138581.1.7808 WP_001138581.1.78089 WP_001138581.1.78099 WP_001138581.1.78196 WP_001138581.1.78235 WP_001138581.1.78321 WP_001138581.1.784 WP_001138581.1.78413 WP_001138581.1.78462 WP_001138581.1.7847 WP_001138581.1.78481 WP_001138581.1.7855 WP_001138581.1.78583 WP_001138581.1.78593 WP_001138581.1.78610 WP_001138581.1.78611 WP_001138581.1.78612 WP_001138581.1.78615 WP_001138581.1.78645 WP_001138581.1.78683 WP_001138581.1.78718 WP_001138581.1.78750 WP_001138581.1.78775 WP_001138581.1.78843 WP_001138581.1.78854 WP_001138581.1.78891 WP_001138581.1.78919 WP_001138581.1.7896 WP_001138581.1.78966 WP_001138581.1.7898 WP_001138581.1.79004 WP_001138581.1.7901 WP_001138581.1.79075 WP_001138581.1.79086 WP_001138581.1.79172 WP_001138581.1.79246 WP_001138581.1.79306 WP_001138581.1.79312 WP_001138581.1.79343 WP_001138581.1.79346 WP_001138581.1.79356 WP_001138581.1.79369 WP_001138581.1.7937 WP_001138581.1.7940 WP_001138581.1.79478 WP_001138581.1.79505 WP_001138581.1.79519 WP_001138581.1.79525 WP_001138581.1.79526 WP_001138581.1.79528 WP_001138581.1.79558 WP_001138581.1.79563 WP_001138581.1.79576 WP_001138581.1.79685 WP_001138581.1.79715 WP_001138581.1.79764 WP_001138581.1.79816 WP_001138581.1.79840 WP_001138581.1.7987 WP_001138581.1.79871 WP_001138581.1.79877 WP_001138581.1.7993 WP_001138581.1.79930 WP_001138581.1.79931 WP_001138581.1.79965 WP_001138581.1.79984 WP_001138581.1.80043 WP_001138581.1.80050 WP_001138581.1.8007 WP_001138581.1.80071 WP_001138581.1.80136 WP_001138581.1.80141 WP_001138581.1.80176 WP_001138581.1.80179 WP_001138581.1.80183 WP_001138581.1.80255 WP_001138581.1.80309 WP_001138581.1.80310 WP_001138581.1.80320 WP_001138581.1.80330 WP_001138581.1.80426 WP_001138581.1.80428 WP_001138581.1.80440 WP_001138581.1.80444 WP_001138581.1.80517 WP_001138581.1.8057 WP_001138581.1.80578 WP_001138581.1.80606 WP_001138581.1.80612 WP_001138581.1.80709 WP_001138581.1.80737 WP_001138581.1.80753 WP_001138581.1.80756 WP_001138581.1.80768 WP_001138581.1.80804 WP_001138581.1.80884 WP_001138581.1.80894 WP_001138581.1.8090 WP_001138581.1.80945 WP_001138581.1.80946 WP_001138581.1.810 WP_001138581.1.81034 WP_001138581.1.81054 WP_001138581.1.81070 WP_001138581.1.811 WP_001138581.1.81104 WP_001138581.1.81127 WP_001138581.1.81160 WP_001138581.1.81182 WP_001138581.1.8121 WP_001138581.1.81273 WP_001138581.1.81283 WP_001138581.1.8129 WP_001138581.1.81313 WP_001138581.1.81316 WP_001138581.1.81376 WP_001138581.1.81391 WP_001138581.1.81420 WP_001138581.1.81442 WP_001138581.1.81484 WP_001138581.1.81514 WP_001138581.1.81517 WP_001138581.1.81576 WP_001138581.1.81577 WP_001138581.1.81589 WP_001138581.1.81596 WP_001138581.1.81715 WP_001138581.1.81723 WP_001138581.1.81754 WP_001138581.1.81806 WP_001138581.1.81821 WP_001138581.1.81832 WP_001138581.1.81873 WP_001138581.1.81934 WP_001138581.1.81935 WP_001138581.1.81939 WP_001138581.1.81975 WP_001138581.1.82010 WP_001138581.1.82057 WP_001138581.1.82059 WP_001138581.1.82062 WP_001138581.1.82074 WP_001138581.1.82239 WP_001138581.1.82240 WP_001138581.1.82242 WP_001138581.1.82246 WP_001138581.1.82275 WP_001138581.1.82296 WP_001138581.1.82316 WP_001138581.1.82326 WP_001138581.1.8235 WP_001138581.1.82378 WP_001138581.1.82439 WP_001138581.1.82485 WP_001138581.1.82499 WP_001138581.1.82536 WP_001138581.1.82572 WP_001138581.1.82594 WP_001138581.1.82626 WP_001138581.1.82629 WP_001138581.1.82647 WP_001138581.1.8268 WP_001138581.1.82700 WP_001138581.1.82715 WP_001138581.1.82718 WP_001138581.1.82754 WP_001138581.1.8277 WP_001138581.1.82797 WP_001138581.1.82820 WP_001138581.1.82831 WP_001138581.1.82902 WP_001138581.1.83020 WP_001138581.1.8308 WP_001138581.1.83093 WP_001138581.1.83097 WP_001138581.1.83099 WP_001138581.1.831 WP_001138581.1.83140 WP_001138581.1.83144 WP_001138581.1.83224 WP_001138581.1.83415 WP_001138581.1.8345 WP_001138581.1.83481 WP_001138581.1.83537 WP_001138581.1.83544 WP_001138581.1.83584 WP_001138581.1.83684 WP_001138581.1.83712 WP_001138581.1.83735 WP_001138581.1.83762 WP_001138581.1.83781 WP_001138581.1.83820 WP_001138581.1.83941 WP_001138581.1.83947 WP_001138581.1.84004 WP_001138581.1.84060 WP_001138581.1.8411 WP_001138581.1.84140 WP_001138581.1.84172 WP_001138581.1.84185 WP_001138581.1.84210 WP_001138581.1.84219 WP_001138581.1.84264 WP_001138581.1.84298 WP_001138581.1.84312 WP_001138581.1.84313 WP_001138581.1.84331 WP_001138581.1.84339 WP_001138581.1.84405 WP_001138581.1.84410 WP_001138581.1.84436 WP_001138581.1.8444 WP_001138581.1.84467 WP_001138581.1.84473 WP_001138581.1.84482 WP_001138581.1.84511 WP_001138581.1.84534 WP_001138581.1.84584 WP_001138581.1.84635 WP_001138581.1.84656 WP_001138581.1.84657 WP_001138581.1.84668 WP_001138581.1.84697 WP_001138581.1.84738 WP_001138581.1.84740 WP_001138581.1.8477 WP_001138581.1.84850 WP_001138581.1.84877 WP_001138581.1.84881 WP_001138581.1.84893 WP_001138581.1.84929 WP_001138581.1.84972 WP_001138581.1.84977 WP_001138581.1.84989 WP_001138581.1.84994 WP_001138581.1.85002 WP_001138581.1.85052 WP_001138581.1.85098 WP_001138581.1.85105 WP_001138581.1.85112 WP_001138581.1.85129 WP_001138581.1.85155 WP_001138581.1.85175 WP_001138581.1.85216 WP_001138581.1.85247 WP_001138581.1.85253 WP_001138581.1.85260 WP_001138581.1.85310 WP_001138581.1.85323 WP_001138581.1.85335 WP_001138581.1.85342 WP_001138581.1.85435 WP_001138581.1.85525 WP_001138581.1.85558 WP_001138581.1.8560 WP_001138581.1.85621 WP_001138581.1.85722 WP_001138581.1.85752 WP_001138581.1.85772 WP_001138581.1.85773 WP_001138581.1.8579 WP_001138581.1.85857 WP_001138581.1.8592 WP_001138581.1.85948 WP_001138581.1.86001 WP_001138581.1.8607 WP_001138581.1.86105 WP_001138581.1.86115 WP_001138581.1.86149 WP_001138581.1.86171 WP_001138581.1.86181 WP_001138581.1.86189 WP_001138581.1.8621 WP_001138581.1.86225 WP_001138581.1.86228 WP_001138581.1.86255 WP_001138581.1.86263 WP_001138581.1.86276 WP_001138581.1.86307 WP_001138581.1.86340 WP_001138581.1.86355 WP_001138581.1.86393 WP_001138581.1.86411 WP_001138581.1.86412 WP_001138581.1.86451 WP_001138581.1.86452 WP_001138581.1.86454 WP_001138581.1.86461 WP_001138581.1.86475 WP_001138581.1.86492 WP_001138581.1.8652 WP_001138581.1.86574 WP_001138581.1.86598 WP_001138581.1.86609 WP_001138581.1.86640 WP_001138581.1.86667 WP_001138581.1.86674 WP_001138581.1.86691 WP_001138581.1.86787 WP_001138581.1.86833 WP_001138581.1.86848 WP_001138581.1.8687 WP_001138581.1.86959 WP_001138581.1.86994 WP_001138581.1.86997 WP_001138581.1.87075 WP_001138581.1.87076 WP_001138581.1.87109 WP_001138581.1.87199 WP_001138581.1.87247 WP_001138581.1.87249 WP_001138581.1.87254 WP_001138581.1.87310 WP_001138581.1.87382 WP_001138581.1.87389 WP_001138581.1.87410 WP_001138581.1.87465 WP_001138581.1.87563 WP_001138581.1.87574 WP_001138581.1.87610 WP_001138581.1.87616 WP_001138581.1.87639 WP_001138581.1.87655 WP_001138581.1.87694 WP_001138581.1.87721 WP_001138581.1.87726 WP_001138581.1.87728 WP_001138581.1.87788 WP_001138581.1.87834 WP_001138581.1.87857 WP_001138581.1.87914 WP_001138581.1.87919 WP_001138581.1.87973 WP_001138581.1.87989 WP_001138581.1.88017 WP_001138581.1.88110 WP_001138581.1.88197 WP_001138581.1.88238 WP_001138581.1.88252 WP_001138581.1.88301 WP_001138581.1.88304 WP_001138581.1.88376 WP_001138581.1.88379 WP_001138581.1.88384 WP_001138581.1.88427 WP_001138581.1.8843 WP_001138581.1.88434 WP_001138581.1.88462 WP_001138581.1.88524 WP_001138581.1.88528 WP_001138581.1.88535 WP_001138581.1.88539 WP_001138581.1.88598 WP_001138581.1.88603 WP_001138581.1.88607 WP_001138581.1.88631 WP_001138581.1.88646 WP_001138581.1.88667 WP_001138581.1.88709 WP_001138581.1.88710 WP_001138581.1.88711 WP_001138581.1.88729 WP_001138581.1.88759 WP_001138581.1.8879 WP_001138581.1.88803 WP_001138581.1.88834 WP_001138581.1.88883 WP_001138581.1.88891 WP_001138581.1.88950 WP_001138581.1.88961 WP_001138581.1.88997 WP_001138581.1.89050 WP_001138581.1.8906 WP_001138581.1.89067 WP_001138581.1.89090 WP_001138581.1.89099 WP_001138581.1.89183 WP_001138581.1.89197 WP_001138581.1.89200 WP_001138581.1.89255 WP_001138581.1.89305 WP_001138581.1.89322 WP_001138581.1.8938 WP_001138581.1.89385 WP_001138581.1.894 WP_001138581.1.89405 WP_001138581.1.89416 WP_001138581.1.89458 WP_001138581.1.89468 WP_001138581.1.89471 WP_001138581.1.89474 WP_001138581.1.89479 WP_001138581.1.89569 WP_001138581.1.89601 WP_001138581.1.89646 WP_001138581.1.89674 WP_001138581.1.89679 WP_001138581.1.89781 WP_001138581.1.89788 WP_001138581.1.89818 WP_001138581.1.89839 WP_001138581.1.89852 WP_001138581.1.89859 WP_001138581.1.89915 WP_001138581.1.89923 WP_001138581.1.89927 WP_001138581.1.89959 WP_001138581.1.89977 WP_001138581.1.89988 WP_001138581.1.90017 WP_001138581.1.90063 WP_001138581.1.90078 WP_001138581.1.9010 WP_001138581.1.90128 WP_001138581.1.90139 WP_001138581.1.90146 WP_001138581.1.90156 WP_001138581.1.90168 WP_001138581.1.90205 WP_001138581.1.90219 WP_001138581.1.90256 WP_001138581.1.90257 WP_001138581.1.90266 WP_001138581.1.90270 WP_001138581.1.90342 WP_001138581.1.90349 WP_001138581.1.90358 WP_001138581.1.9036 WP_001138581.1.90389 WP_001138581.1.90405 WP_001138581.1.90435 WP_001138581.1.90441 WP_001138581.1.90467 WP_001138581.1.90511 WP_001138581.1.90520 WP_001138581.1.90536 WP_001138581.1.90591 WP_001138581.1.9061 WP_001138581.1.90626 WP_001138581.1.90703 WP_001138581.1.90706 WP_001138581.1.90799 WP_001138581.1.9081 WP_001138581.1.90813 WP_001138581.1.90822 WP_001138581.1.90828 WP_001138581.1.90834 WP_001138581.1.90837 WP_001138581.1.90839 WP_001138581.1.90848 WP_001138581.1.90864 WP_001138581.1.90865 WP_001138581.1.90873 WP_001138581.1.90924 WP_001138581.1.90951 WP_001138581.1.90967 WP_001138581.1.9098 WP_001138581.1.90997 WP_001138581.1.91018 WP_001138581.1.91072 WP_001138581.1.91088 WP_001138581.1.91094 WP_001138581.1.91113 WP_001138581.1.91121 WP_001138581.1.91153 WP_001138581.1.91170 WP_001138581.1.91266 WP_001138581.1.91268 WP_001138581.1.91277 WP_001138581.1.91288 WP_001138581.1.91340 WP_001138581.1.91341 WP_001138581.1.91356 WP_001138581.1.91384 WP_001138581.1.91445 WP_001138581.1.91462 WP_001138581.1.91485 WP_001138581.1.91548 WP_001138581.1.91551 WP_001138581.1.91565 WP_001138581.1.91596 WP_001138581.1.9160 WP_001138581.1.91640 WP_001138581.1.91643 WP_001138581.1.91644 WP_001138581.1.91651 WP_001138581.1.91672 WP_001138581.1.9168 WP_001138581.1.9169 WP_001138581.1.9171 WP_001138581.1.91739 WP_001138581.1.91777 WP_001138581.1.91787 WP_001138581.1.91801 WP_001138581.1.91871 WP_001138581.1.91879 WP_001138581.1.91959 WP_001138581.1.91971 WP_001138581.1.91994 WP_001138581.1.92014 WP_001138581.1.92019 WP_001138581.1.92031 WP_001138581.1.92048 WP_001138581.1.92058 WP_001138581.1.921 WP_001138581.1.92114 WP_001138581.1.9215 WP_001138581.1.92161 WP_001138581.1.92163 WP_001138581.1.92180 WP_001138581.1.92215 WP_001138581.1.92224 WP_001138581.1.92311 WP_001138581.1.92323 WP_001138581.1.92361 WP_001138581.1.92434 WP_001138581.1.92496 WP_001138581.1.92568 WP_001138581.1.92577 WP_001138581.1.92614 WP_001138581.1.92615 WP_001138581.1.9266 WP_001138581.1.92668 WP_001138581.1.92693 WP_001138581.1.92742 WP_001138581.1.92792 WP_001138581.1.92819 WP_001138581.1.92845 WP_001138581.1.92865 WP_001138581.1.92943 WP_001138581.1.92953 WP_001138581.1.92989 WP_001138581.1.93016 WP_001138581.1.93019 WP_001138581.1.93027 WP_001138581.1.93048 WP_001138581.1.93054 WP_001138581.1.93069 WP_001138581.1.93133 WP_001138581.1.93175 WP_001138581.1.93252 WP_001138581.1.93276 WP_001138581.1.93309 WP_001138581.1.93312 WP_001138581.1.93338 WP_001138581.1.93388 WP_001138581.1.93427 WP_001138581.1.93428 WP_001138581.1.93463 WP_001138581.1.93509 WP_001138581.1.93531 WP_001138581.1.93569 WP_001138581.1.93601 WP_001138581.1.93630 WP_001138581.1.93634 WP_001138581.1.93637 WP_001138581.1.93652 WP_001138581.1.93665 WP_001138581.1.93670 WP_001138581.1.93673 WP_001138581.1.93695 WP_001138581.1.93733 WP_001138581.1.93745 WP_001138581.1.93755 WP_001138581.1.93800 WP_001138581.1.93821 WP_001138581.1.93873 WP_001138581.1.93911 WP_001138581.1.93951 WP_001138581.1.93971 WP_001138581.1.94008 WP_001138581.1.94011 WP_001138581.1.94025 WP_001138581.1.94057 WP_001138581.1.94176 WP_001138581.1.94187 WP_001138581.1.94213 WP_001138581.1.94232 WP_001138581.1.9426 WP_001138581.1.94271 WP_001138581.1.94302 WP_001138581.1.94317 WP_001138581.1.94343 WP_001138581.1.94388 WP_001138581.1.94404 WP_001138581.1.94445 WP_001138581.1.94475 WP_001138581.1.94507 WP_001138581.1.94542 WP_001138581.1.94544 WP_001138581.1.94548 WP_001138581.1.9457 WP_001138581.1.94578 WP_001138581.1.94580 WP_001138581.1.94589 WP_001138581.1.94626 WP_001138581.1.94676 WP_001138581.1.94692 WP_001138581.1.94695 WP_001138581.1.94738 WP_001138581.1.94754 WP_001138581.1.94764 WP_001138581.1.94787 WP_001138581.1.94790 WP_001138581.1.948 WP_001138581.1.94822 WP_001138581.1.94880 WP_001138581.1.94889 WP_001138581.1.9489 WP_001138581.1.94898 WP_001138581.1.94935 WP_001138581.1.94938 WP_001138581.1.94949 WP_001138581.1.94991 WP_001138581.1.94993 WP_001138581.1.95005 WP_001138581.1.95011 WP_001138581.1.95022 WP_001138581.1.95028 WP_001138581.1.95035 WP_001138581.1.95062 WP_001138581.1.95129 WP_001138581.1.95161 WP_001138581.1.95198 WP_001138581.1.95243 WP_001138581.1.95332 WP_001138581.1.95368 WP_001138581.1.95390 WP_001138581.1.95395 WP_001138581.1.95400 WP_001138581.1.95424 WP_001138581.1.95438 WP_001138581.1.95490 WP_001138581.1.95563 WP_001138581.1.95604 WP_001138581.1.95611 WP_001138581.1.95771 WP_001138581.1.95827 WP_001138581.1.95834 WP_001138581.1.95849 WP_001138581.1.95865 WP_001138581.1.95869 WP_001138581.1.95916 WP_001138581.1.95919 WP_001138581.1.95931 WP_001138581.1.960 WP_001138581.1.96086 WP_001138581.1.96114 WP_001138581.1.9616 WP_001138581.1.96215 WP_001138581.1.96229 WP_001138581.1.96247 WP_001138581.1.96279 WP_001138581.1.96281 WP_001138581.1.96290 WP_001138581.1.96299 WP_001138581.1.96303 WP_001138581.1.96339 WP_001138581.1.96394 WP_001138581.1.96417 WP_001138581.1.96425 WP_001138581.1.96450 WP_001138581.1.96479 WP_001138581.1.96480 WP_001138581.1.96494 WP_001138581.1.96541 WP_001138581.1.9657 WP_001138581.1.96609 WP_001138581.1.96725 WP_001138581.1.96796 WP_001138581.1.96817 WP_001138581.1.9690 WP_001138581.1.96936 WP_001138581.1.96984 WP_001138581.1.97011 WP_001138581.1.97027 WP_001138581.1.97059 WP_001138581.1.97123 WP_001138581.1.97193 WP_001138581.1.97231 WP_001138581.1.97238 WP_001138581.1.97248 WP_001138581.1.9729 WP_001138581.1.97344 WP_001138581.1.97356 WP_001138581.1.97360 WP_001138581.1.97361 WP_001138581.1.9740 WP_001138581.1.97402 WP_001138581.1.97418 WP_001138581.1.97434 WP_001138581.1.97459 WP_001138581.1.9747 WP_001138581.1.97490 WP_001138581.1.97513 WP_001138581.1.97538 WP_001138581.1.97619 WP_001138581.1.97632 WP_001138581.1.97667 WP_001138581.1.97677 WP_001138581.1.97685 WP_001138581.1.9770 WP_001138581.1.97789 WP_001138581.1.97825 WP_001138581.1.97871 WP_001138581.1.97930 WP_001138581.1.97932 WP_001138581.1.97937 WP_001138581.1.97962 WP_001138581.1.98012 WP_001138581.1.9803 WP_001138581.1.98046 WP_001138581.1.98082 WP_001138581.1.98083 WP_001138581.1.981 WP_001138581.1.98115 WP_001138581.1.98139 WP_001138581.1.98155 WP_001138581.1.9816 WP_001138581.1.9817 WP_001138581.1.98176 WP_001138581.1.98187 WP_001138581.1.98205 WP_001138581.1.98235 WP_001138581.1.98239 WP_001138581.1.98241 WP_001138581.1.98244 WP_001138581.1.98279 WP_001138581.1.98294 WP_001138581.1.98312 WP_001138581.1.98355 WP_001138581.1.98357 WP_001138581.1.98384 WP_001138581.1.98400 WP_001138581.1.98424 WP_001138581.1.9844 WP_001138581.1.98442 WP_001138581.1.98477 WP_001138581.1.98543 WP_001138581.1.98549 WP_001138581.1.98569 WP_001138581.1.9858 WP_001138581.1.98628 WP_001138581.1.9864 WP_001138581.1.98665 WP_001138581.1.98683 WP_001138581.1.98776 WP_001138581.1.9883 WP_001138581.1.98875 WP_001138581.1.98920 WP_001138581.1.98988 WP_001138581.1.99029 WP_001138581.1.99101 WP_001138581.1.99168 WP_001138581.1.99182 WP_001138581.1.99209 WP_001138581.1.99234 WP_001138581.1.99246 WP_001138581.1.99292 WP_001138581.1.99295 WP_001138581.1.99302 WP_001138581.1.99310 WP_001138581.1.99319 WP_001138581.1.99345 WP_001138581.1.99361 WP_001138581.1.99392 WP_001138581.1.9940 WP_001138581.1.99400 WP_001138581.1.99446 WP_001138581.1.99453 WP_001138581.1.99471 WP_001138581.1.99475 WP_001138581.1.99486 WP_001138581.1.99487 WP_001138581.1.99501 WP_001138581.1.99511 WP_001138581.1.99534 WP_001138581.1.99562 WP_001138581.1.99602 WP_001138581.1.99603 WP_001138581.1.99619 WP_001138581.1.99666 WP_001138581.1.99692 WP_001138581.1.99827 WP_001138581.1.99929 WP_001138581.1.99986 gi|387621301|ref|YP_006128928.1| gi|254793201|ref|YP_003078038.1| gi|260843888|ref|YP_003221666.1| gi|443617661|ref|YP_007381517.1| gi|253773460|ref|YP_003036291.1| gi|170081248|ref|YP_001730568.1| gi|15831544|ref|NP_310317.1| gi|378712980|ref|YP_005277873.1| gi|387506827|ref|YP_006159083.1| cath|current|4r9mA00/1-172 gi|170020063|ref|YP_001725017.1| gi|291282716|ref|YP_003499534.1| gi|209918896|ref|YP_002292980.1| gi|16129542|ref|NP_416101.1| gi|386704682|ref|YP_006168529.1| gi|544390237|ref|YP_008564757.1| 155864.Z2571 316385.ECDH10B_1717 316407.speG 331111.EcE24377A_1791 331112.EcHS_A1657 386585.ECs2290 409438.ECSE_1705 413997.ECB_01553 444450.ECH74115_2293 469008.ECBD_2062 481805.EcolC_2046 511145.b1584 544404.ECSP_2148 585034.ECIAI1_1634 585395.ECO103_1723 585396.ECO111_2051 595496.BWG_1398 gi|378712980|ref|YP_005277873.1| gi|15801998|ref|NP_288019.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]