SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15831779|ref|NP_310552.1| from Escherichia coli O157:H7 str. Sakai

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15831779|ref|NP_310552.1|
Domain Number 1 Region: 288-422
Classification Level Classification E-value
Superfamily CBS-domain pair 3.41e-22
Family CBS-domain pair 0.0052
Further Details:      
 
Domain Number 2 Region: 432-517
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.82e-18
Family CorC/HlyC domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15831779|ref|NP_310552.1|
Sequence length 518
Comment transporter [Escherichia coli O157:H7 str. Sakai]
Sequence
MEFLMDPSIWAGLLTLVVLEIVLGIDNLVFIAILADKLPPKQRDKARLLGLSLALIMRLG
LLSLISWMVTLTKPLFTVMDFSFSGRDLIMLFGGIFLLFKATTELHERLENRDHDSGHGK
GYASFWVVVTQIVILDAVFSLDAVITAVGMVNHLPVMMAAVVIAMAVMLLASKPLTRFVN
QHPTVVVLCLSFLLMIGLSLVAEGFGFHIPKGYLYAAIGFSIIIEVFNQIARRNFIRHQS
TLPLRARTADAILRLMGGKRQANVQHDADNPMPMPIPEGAFAEEERYMINGVLTLASRSL
RGIMTPRGEISWVDANLGVDEIREQLLSSPHSLFPVCRGELDEIIGIVRAKELLVALEEG
VDVAAIASASPAIIVPETLDPINLLGVLRRARGSFVIVTNEFGVVQGLVTPLDVLEAIAG
EFPDADETPEIITDGDGWLVKGGTDLHALQQALDVEHLADDDDIATVAGLVISANGHIPR
VGDVIDVGPLHITIIEANDYRVDLVRIVKEQPAHDEDE
Download sequence
Identical sequences A0A023YY91 A0A024KXM3 A0A025CNF6 A0A027TRZ2 A0A027ZLK1 A0A028E2D9 A0A029HZ11 A0A029IT35 A0A069XI33 A0A070SW93 A0A070V2U9 A0A073FUJ0 A0A073HH25 A0A073USW5 A0A074HXG9 A0A080G0K4 A0A0A0FF61 A0A0A8U917 A0A0E0U0H8 A0A0E0XY23 A0A0E1M043 A0A0E1T4S8 A0A0E2L4D9 A0A0E2TSU4 A0A0F6C5A8 A0A0F6F7H2 A0A0G3K835 A0A0H2YZF6 A0A0H3EIB2 A0A0H3PLK0 A0A0I1IBR0 A0A0M7PP55 A0A140N6E0 A0A142H3Q7 A0A181WQE0 A0A192C6V7 A0A1E3N543 A0A1S6TBD2 A0A1S9K6C3 A0A1X3IMZ6 A0A1X3IZE2 A0A1X3JGR4 A0A1X3KBL8 A0A1X3L2D4 A0A1X3LKD7 A0A222QL08 A0A236USZ9 A0A2A2XR99 A0A2D0P6B0 A0A2H1BF87 A0A2J9MT69 A7ZMT8 B1LD57 B6IBP3 B7L6U4 B7MBM2 B7MVU5 B7NBG2 B7USJ1 C8UA73 C8UBR4 D3QVT1 D6HXU7 D6IBC6 D6JA94 D7X959 D7Y1K8 D7ZL49 D8E907 E2QN18 E3PNK1 E3XP28 E9THK4 F3WJ52 F4SKW9 F4SZ46 F4TFE4 F4V2W8 F4VG63 G0F6T3 H4IBU5 H4ISQ4 H4J901 H4KHT7 H4LCQ1 H4UHZ3 I2SPL4 I2UJG1 I2WTI5 I2XDA9 I4SWE7 I6FVJ7 J7RRZ8 K4V6N2 K4WG94 L2V1S8 L2XNP4 L3Q7P3 M9H605 P0AEC0 P0AEC1 P0AEC2 Q1RAX6 S0W0U7 S1DUQ1 S1EW09 S1HH22 S1I8L1 S1IUQ5 S1PK58 T5V6N8 T6HDW1 T9CY21 U9XWQ8 U9YDA3 U9YZ69 U9Z5U2 U9ZGH0 V0S9X9 V0VKN6 V0ZF70 V2QXG7 V2TE99 V6FRQ6 V8FMA5 W1B9I4 W1WXV2 W8ZJP1
gi|387621535|ref|YP_006129162.1| 199310.c2222 316385.ECDH10B_1954 316407.yoaE 331111.EcE24377A_2044 331112.EcHS_A1906 362663.ECP_1759 364106.UTI89_C2012 386585.ECs2525 405955.APECO1_873 409438.ECSE_1990 413997.ECB_01786 439855.EcSMS35_1372 444450.ECH74115_2545 469008.ECBD_1826 481805.EcolC_1817 511145.b1816 544404.ECSP_2389 573235.ECO26_2585 574521.E2348C_1939 585034.ECIAI1_1885 585035.ECS88_1868 585055.EC55989_1989 585056.ECUMN_2108 585395.ECO103_2005 585396.ECO111_2322 585397.ECED1_2019 595496.BWG_1629 gi|238901030|ref|YP_002926826.1| gi|410482269|ref|YP_006769815.1| gi|251785263|ref|YP_002999567.1| gi|471333656|ref|YP_007557133.1| gi|254161875|ref|YP_003044983.1| gi|386599612|ref|YP_006101118.1| gi|260868335|ref|YP_003234737.1| gi|387617151|ref|YP_006120173.1| gi|291282996|ref|YP_003499814.1| gi|407481720|ref|YP_006778869.1| 3173S ECCORB4 gi|407469616|ref|YP_006783941.1| gi|26248076|ref|NP_754116.1| gi|386614371|ref|YP_006134037.1| gi|260855675|ref|YP_003229566.1| gi|386639342|ref|YP_006106140.1| gi|254793439|ref|YP_003078276.1| gi|218705314|ref|YP_002412833.1| gi|218554388|ref|YP_002387301.1| gi|388477889|ref|YP_490077.1| gi|386619383|ref|YP_006138963.1| gi|209398900|ref|YP_002270895.1| gi|386704454|ref|YP_006168301.1| gi|387612303|ref|YP_006115419.1| gi|387829725|ref|YP_003349662.1| gi|260844160|ref|YP_003221938.1| gi|218689752|ref|YP_002397964.1| gi|386604221|ref|YP_006110521.1| gi|218695378|ref|YP_002403045.1| NP_310552.1.58667 NP_416330.1.90541 WP_000394983.1.1000 WP_000394983.1.10001 WP_000394983.1.100014 WP_000394983.1.100044 WP_000394983.1.100052 WP_000394983.1.100066 WP_000394983.1.100073 WP_000394983.1.100085 WP_000394983.1.10010 WP_000394983.1.100111 WP_000394983.1.100116 WP_000394983.1.100151 WP_000394983.1.100159 WP_000394983.1.100185 WP_000394983.1.100194 WP_000394983.1.100220 WP_000394983.1.100227 WP_000394983.1.100251 WP_000394983.1.100252 WP_000394983.1.100281 WP_000394983.1.100283 WP_000394983.1.100299 WP_000394983.1.100304 WP_000394983.1.100306 WP_000394983.1.10034 WP_000394983.1.100346 WP_000394983.1.100425 WP_000394983.1.100441 WP_000394983.1.100444 WP_000394983.1.100451 WP_000394983.1.100474 WP_000394983.1.100487 WP_000394983.1.100499 WP_000394983.1.10051 WP_000394983.1.100543 WP_000394983.1.100554 WP_000394983.1.100571 WP_000394983.1.100573 WP_000394983.1.100614 WP_000394983.1.10068 WP_000394983.1.100685 WP_000394983.1.100688 WP_000394983.1.100689 WP_000394983.1.100718 WP_000394983.1.100735 WP_000394983.1.100738 WP_000394983.1.100752 WP_000394983.1.100758 WP_000394983.1.10080 WP_000394983.1.100803 WP_000394983.1.100824 WP_000394983.1.100836 WP_000394983.1.100851 WP_000394983.1.100867 WP_000394983.1.100868 WP_000394983.1.100925 WP_000394983.1.100950 WP_000394983.1.100959 WP_000394983.1.100966 WP_000394983.1.100990 WP_000394983.1.10100 WP_000394983.1.101033 WP_000394983.1.101052 WP_000394983.1.101087 WP_000394983.1.101096 WP_000394983.1.1011 WP_000394983.1.101102 WP_000394983.1.101105 WP_000394983.1.101110 WP_000394983.1.101148 WP_000394983.1.101152 WP_000394983.1.101166 WP_000394983.1.101186 WP_000394983.1.101206 WP_000394983.1.101216 WP_000394983.1.101255 WP_000394983.1.101257 WP_000394983.1.10126 WP_000394983.1.101282 WP_000394983.1.101289 WP_000394983.1.101293 WP_000394983.1.10131 WP_000394983.1.101313 WP_000394983.1.101359 WP_000394983.1.10138 WP_000394983.1.101399 WP_000394983.1.101418 WP_000394983.1.101423 WP_000394983.1.101429 WP_000394983.1.101436 WP_000394983.1.101439 WP_000394983.1.101468 WP_000394983.1.101518 WP_000394983.1.10154 WP_000394983.1.101583 WP_000394983.1.101628 WP_000394983.1.101630 WP_000394983.1.101651 WP_000394983.1.101653 WP_000394983.1.101654 WP_000394983.1.101686 WP_000394983.1.101693 WP_000394983.1.101694 WP_000394983.1.101727 WP_000394983.1.10173 WP_000394983.1.101737 WP_000394983.1.101747 WP_000394983.1.101769 WP_000394983.1.101777 WP_000394983.1.101786 WP_000394983.1.10181 WP_000394983.1.101822 WP_000394983.1.10184 WP_000394983.1.101840 WP_000394983.1.101845 WP_000394983.1.101855 WP_000394983.1.101865 WP_000394983.1.10187 WP_000394983.1.10188 WP_000394983.1.10190 WP_000394983.1.101900 WP_000394983.1.101913 WP_000394983.1.101932 WP_000394983.1.101947 WP_000394983.1.101948 WP_000394983.1.101969 WP_000394983.1.101984 WP_000394983.1.101987 WP_000394983.1.102021 WP_000394983.1.102036 WP_000394983.1.10206 WP_000394983.1.102069 WP_000394983.1.102076 WP_000394983.1.102106 WP_000394983.1.102122 WP_000394983.1.102139 WP_000394983.1.102144 WP_000394983.1.10222 WP_000394983.1.10235 WP_000394983.1.10252 WP_000394983.1.10273 WP_000394983.1.10304 WP_000394983.1.10326 WP_000394983.1.10335 WP_000394983.1.10379 WP_000394983.1.10381 WP_000394983.1.1040 WP_000394983.1.10461 WP_000394983.1.10476 WP_000394983.1.10491 WP_000394983.1.10492 WP_000394983.1.10496 WP_000394983.1.10524 WP_000394983.1.10538 WP_000394983.1.10569 WP_000394983.1.10573 WP_000394983.1.10579 WP_000394983.1.1058 WP_000394983.1.10607 WP_000394983.1.10651 WP_000394983.1.10673 WP_000394983.1.10697 WP_000394983.1.1071 WP_000394983.1.10715 WP_000394983.1.1073 WP_000394983.1.1074 WP_000394983.1.10744 WP_000394983.1.10761 WP_000394983.1.10763 WP_000394983.1.10786 WP_000394983.1.10787 WP_000394983.1.10798 WP_000394983.1.10814 WP_000394983.1.10824 WP_000394983.1.10833 WP_000394983.1.10842 WP_000394983.1.10849 WP_000394983.1.10869 WP_000394983.1.10922 WP_000394983.1.10940 WP_000394983.1.10970 WP_000394983.1.10988 WP_000394983.1.10989 WP_000394983.1.10994 WP_000394983.1.11032 WP_000394983.1.11047 WP_000394983.1.11052 WP_000394983.1.11057 WP_000394983.1.11068 WP_000394983.1.11071 WP_000394983.1.11091 WP_000394983.1.1111 WP_000394983.1.11113 WP_000394983.1.11118 WP_000394983.1.1113 WP_000394983.1.11133 WP_000394983.1.112 WP_000394983.1.11217 WP_000394983.1.1122 WP_000394983.1.11240 WP_000394983.1.11241 WP_000394983.1.11250 WP_000394983.1.11285 WP_000394983.1.11315 WP_000394983.1.11399 WP_000394983.1.11411 WP_000394983.1.11420 WP_000394983.1.11436 WP_000394983.1.11437 WP_000394983.1.11467 WP_000394983.1.11519 WP_000394983.1.11524 WP_000394983.1.11531 WP_000394983.1.11542 WP_000394983.1.11575 WP_000394983.1.11578 WP_000394983.1.11607 WP_000394983.1.11608 WP_000394983.1.11612 WP_000394983.1.11616 WP_000394983.1.11645 WP_000394983.1.11671 WP_000394983.1.11673 WP_000394983.1.1168 WP_000394983.1.11699 WP_000394983.1.11748 WP_000394983.1.11759 WP_000394983.1.1176 WP_000394983.1.11762 WP_000394983.1.11801 WP_000394983.1.11803 WP_000394983.1.11844 WP_000394983.1.1186 WP_000394983.1.11949 WP_000394983.1.11955 WP_000394983.1.11956 WP_000394983.1.1196 WP_000394983.1.11982 WP_000394983.1.11985 WP_000394983.1.12009 WP_000394983.1.12010 WP_000394983.1.12030 WP_000394983.1.12036 WP_000394983.1.12050 WP_000394983.1.12060 WP_000394983.1.12076 WP_000394983.1.12088 WP_000394983.1.12111 WP_000394983.1.1212 WP_000394983.1.12151 WP_000394983.1.12157 WP_000394983.1.12230 WP_000394983.1.12259 WP_000394983.1.12268 WP_000394983.1.12279 WP_000394983.1.12295 WP_000394983.1.12305 WP_000394983.1.12319 WP_000394983.1.12320 WP_000394983.1.12344 WP_000394983.1.12352 WP_000394983.1.12415 WP_000394983.1.1242 WP_000394983.1.12426 WP_000394983.1.12458 WP_000394983.1.12468 WP_000394983.1.12478 WP_000394983.1.12542 WP_000394983.1.12552 WP_000394983.1.12558 WP_000394983.1.12566 WP_000394983.1.12574 WP_000394983.1.12582 WP_000394983.1.12594 WP_000394983.1.12623 WP_000394983.1.12645 WP_000394983.1.12646 WP_000394983.1.12675 WP_000394983.1.12680 WP_000394983.1.12697 WP_000394983.1.127 WP_000394983.1.12709 WP_000394983.1.12717 WP_000394983.1.12743 WP_000394983.1.12749 WP_000394983.1.1275 WP_000394983.1.12756 WP_000394983.1.12761 WP_000394983.1.12762 WP_000394983.1.12763 WP_000394983.1.12766 WP_000394983.1.12775 WP_000394983.1.1278 WP_000394983.1.12826 WP_000394983.1.12830 WP_000394983.1.12831 WP_000394983.1.12876 WP_000394983.1.12893 WP_000394983.1.12911 WP_000394983.1.12914 WP_000394983.1.12915 WP_000394983.1.12917 WP_000394983.1.1295 WP_000394983.1.12956 WP_000394983.1.12976 WP_000394983.1.12979 WP_000394983.1.12987 WP_000394983.1.12991 WP_000394983.1.13002 WP_000394983.1.13015 WP_000394983.1.13031 WP_000394983.1.13060 WP_000394983.1.13074 WP_000394983.1.1308 WP_000394983.1.13117 WP_000394983.1.1312 WP_000394983.1.13136 WP_000394983.1.1314 WP_000394983.1.1315 WP_000394983.1.13162 WP_000394983.1.13176 WP_000394983.1.13181 WP_000394983.1.13205 WP_000394983.1.13217 WP_000394983.1.13222 WP_000394983.1.13223 WP_000394983.1.1323 WP_000394983.1.13239 WP_000394983.1.13258 WP_000394983.1.13271 WP_000394983.1.13272 WP_000394983.1.13278 WP_000394983.1.13281 WP_000394983.1.13290 WP_000394983.1.13295 WP_000394983.1.13301 WP_000394983.1.13332 WP_000394983.1.13333 WP_000394983.1.13348 WP_000394983.1.13393 WP_000394983.1.13409 WP_000394983.1.1343 WP_000394983.1.13430 WP_000394983.1.13442 WP_000394983.1.13451 WP_000394983.1.13469 WP_000394983.1.13473 WP_000394983.1.13481 WP_000394983.1.13492 WP_000394983.1.13525 WP_000394983.1.13585 WP_000394983.1.13601 WP_000394983.1.13608 WP_000394983.1.13618 WP_000394983.1.13624 WP_000394983.1.13626 WP_000394983.1.13644 WP_000394983.1.13656 WP_000394983.1.13662 WP_000394983.1.13672 WP_000394983.1.13778 WP_000394983.1.13791 WP_000394983.1.13824 WP_000394983.1.13881 WP_000394983.1.13891 WP_000394983.1.13924 WP_000394983.1.13934 WP_000394983.1.13936 WP_000394983.1.13939 WP_000394983.1.13944 WP_000394983.1.13949 WP_000394983.1.13974 WP_000394983.1.14023 WP_000394983.1.14030 WP_000394983.1.14042 WP_000394983.1.14058 WP_000394983.1.14062 WP_000394983.1.14070 WP_000394983.1.14110 WP_000394983.1.14144 WP_000394983.1.14164 WP_000394983.1.1419 WP_000394983.1.14199 WP_000394983.1.14245 WP_000394983.1.14277 WP_000394983.1.14292 WP_000394983.1.14304 WP_000394983.1.14322 WP_000394983.1.14331 WP_000394983.1.14346 WP_000394983.1.14371 WP_000394983.1.1438 WP_000394983.1.1439 WP_000394983.1.14398 WP_000394983.1.14417 WP_000394983.1.14432 WP_000394983.1.14445 WP_000394983.1.14453 WP_000394983.1.14468 WP_000394983.1.14501 WP_000394983.1.14506 WP_000394983.1.14508 WP_000394983.1.14509 WP_000394983.1.14529 WP_000394983.1.14536 WP_000394983.1.14581 WP_000394983.1.14582 WP_000394983.1.14601 WP_000394983.1.14605 WP_000394983.1.14607 WP_000394983.1.1461 WP_000394983.1.14616 WP_000394983.1.14621 WP_000394983.1.14661 WP_000394983.1.14672 WP_000394983.1.14678 WP_000394983.1.14687 WP_000394983.1.14693 WP_000394983.1.1470 WP_000394983.1.14712 WP_000394983.1.14807 WP_000394983.1.14811 WP_000394983.1.14833 WP_000394983.1.14871 WP_000394983.1.14879 WP_000394983.1.14934 WP_000394983.1.14946 WP_000394983.1.14956 WP_000394983.1.14958 WP_000394983.1.14963 WP_000394983.1.14977 WP_000394983.1.14992 WP_000394983.1.14993 WP_000394983.1.15020 WP_000394983.1.15041 WP_000394983.1.1508 WP_000394983.1.15087 WP_000394983.1.15090 WP_000394983.1.1510 WP_000394983.1.15117 WP_000394983.1.1512 WP_000394983.1.15121 WP_000394983.1.15138 WP_000394983.1.15177 WP_000394983.1.15193 WP_000394983.1.15207 WP_000394983.1.15221 WP_000394983.1.1524 WP_000394983.1.15245 WP_000394983.1.15252 WP_000394983.1.15259 WP_000394983.1.15270 WP_000394983.1.15274 WP_000394983.1.15277 WP_000394983.1.15287 WP_000394983.1.15290 WP_000394983.1.153 WP_000394983.1.15300 WP_000394983.1.15332 WP_000394983.1.15335 WP_000394983.1.15347 WP_000394983.1.15377 WP_000394983.1.15416 WP_000394983.1.1543 WP_000394983.1.15444 WP_000394983.1.15453 WP_000394983.1.15469 WP_000394983.1.15496 WP_000394983.1.15503 WP_000394983.1.15521 WP_000394983.1.15527 WP_000394983.1.15528 WP_000394983.1.15538 WP_000394983.1.15576 WP_000394983.1.15583 WP_000394983.1.1559 WP_000394983.1.15593 WP_000394983.1.15600 WP_000394983.1.1561 WP_000394983.1.15620 WP_000394983.1.15624 WP_000394983.1.15626 WP_000394983.1.15645 WP_000394983.1.15654 WP_000394983.1.15702 WP_000394983.1.15707 WP_000394983.1.15731 WP_000394983.1.15740 WP_000394983.1.15747 WP_000394983.1.15752 WP_000394983.1.15762 WP_000394983.1.15767 WP_000394983.1.15782 WP_000394983.1.15809 WP_000394983.1.1582 WP_000394983.1.15857 WP_000394983.1.15863 WP_000394983.1.15869 WP_000394983.1.1588 WP_000394983.1.15906 WP_000394983.1.15916 WP_000394983.1.15945 WP_000394983.1.15949 WP_000394983.1.15951 WP_000394983.1.15983 WP_000394983.1.15984 WP_000394983.1.15990 WP_000394983.1.16010 WP_000394983.1.16014 WP_000394983.1.1604 WP_000394983.1.16067 WP_000394983.1.16075 WP_000394983.1.16086 WP_000394983.1.1609 WP_000394983.1.16111 WP_000394983.1.16131 WP_000394983.1.16133 WP_000394983.1.16154 WP_000394983.1.16171 WP_000394983.1.16175 WP_000394983.1.16179 WP_000394983.1.16183 WP_000394983.1.16194 WP_000394983.1.1621 WP_000394983.1.16222 WP_000394983.1.16270 WP_000394983.1.16272 WP_000394983.1.16294 WP_000394983.1.163 WP_000394983.1.16322 WP_000394983.1.1634 WP_000394983.1.16387 WP_000394983.1.16388 WP_000394983.1.16396 WP_000394983.1.1640 WP_000394983.1.16463 WP_000394983.1.16481 WP_000394983.1.16482 WP_000394983.1.16500 WP_000394983.1.16517 WP_000394983.1.16532 WP_000394983.1.16539 WP_000394983.1.16541 WP_000394983.1.1655 WP_000394983.1.16577 WP_000394983.1.16592 WP_000394983.1.16608 WP_000394983.1.16612 WP_000394983.1.16667 WP_000394983.1.16685 WP_000394983.1.16705 WP_000394983.1.16715 WP_000394983.1.16721 WP_000394983.1.1673 WP_000394983.1.16745 WP_000394983.1.16752 WP_000394983.1.16780 WP_000394983.1.16798 WP_000394983.1.16799 WP_000394983.1.16805 WP_000394983.1.16807 WP_000394983.1.16843 WP_000394983.1.16845 WP_000394983.1.16927 WP_000394983.1.16992 WP_000394983.1.17014 WP_000394983.1.17018 WP_000394983.1.17084 WP_000394983.1.17087 WP_000394983.1.17101 WP_000394983.1.17102 WP_000394983.1.17109 WP_000394983.1.17114 WP_000394983.1.17119 WP_000394983.1.17123 WP_000394983.1.17153 WP_000394983.1.17170 WP_000394983.1.17172 WP_000394983.1.17182 WP_000394983.1.17187 WP_000394983.1.17206 WP_000394983.1.17216 WP_000394983.1.17241 WP_000394983.1.17242 WP_000394983.1.17267 WP_000394983.1.17282 WP_000394983.1.17297 WP_000394983.1.1731 WP_000394983.1.17325 WP_000394983.1.17333 WP_000394983.1.17356 WP_000394983.1.17373 WP_000394983.1.17386 WP_000394983.1.17387 WP_000394983.1.17389 WP_000394983.1.17392 WP_000394983.1.17403 WP_000394983.1.17410 WP_000394983.1.17415 WP_000394983.1.17417 WP_000394983.1.17432 WP_000394983.1.17464 WP_000394983.1.17515 WP_000394983.1.17534 WP_000394983.1.1755 WP_000394983.1.17550 WP_000394983.1.17568 WP_000394983.1.17577 WP_000394983.1.17584 WP_000394983.1.17623 WP_000394983.1.1763 WP_000394983.1.17637 WP_000394983.1.1766 WP_000394983.1.1769 WP_000394983.1.17701 WP_000394983.1.1772 WP_000394983.1.17766 WP_000394983.1.17769 WP_000394983.1.1778 WP_000394983.1.17802 WP_000394983.1.17829 WP_000394983.1.17831 WP_000394983.1.17849 WP_000394983.1.17889 WP_000394983.1.17904 WP_000394983.1.17920 WP_000394983.1.17925 WP_000394983.1.17937 WP_000394983.1.17952 WP_000394983.1.17961 WP_000394983.1.17963 WP_000394983.1.17984 WP_000394983.1.1802 WP_000394983.1.18024 WP_000394983.1.18050 WP_000394983.1.18064 WP_000394983.1.18094 WP_000394983.1.18118 WP_000394983.1.18133 WP_000394983.1.18134 WP_000394983.1.18136 WP_000394983.1.18164 WP_000394983.1.18175 WP_000394983.1.1821 WP_000394983.1.18226 WP_000394983.1.18275 WP_000394983.1.18326 WP_000394983.1.18329 WP_000394983.1.18337 WP_000394983.1.18338 WP_000394983.1.1834 WP_000394983.1.18340 WP_000394983.1.18348 WP_000394983.1.18381 WP_000394983.1.18402 WP_000394983.1.18410 WP_000394983.1.18436 WP_000394983.1.18438 WP_000394983.1.1844 WP_000394983.1.18458 WP_000394983.1.18461 WP_000394983.1.18472 WP_000394983.1.18482 WP_000394983.1.18530 WP_000394983.1.18550 WP_000394983.1.18556 WP_000394983.1.18581 WP_000394983.1.18588 WP_000394983.1.1861 WP_000394983.1.1862 WP_000394983.1.18649 WP_000394983.1.18650 WP_000394983.1.18651 WP_000394983.1.18655 WP_000394983.1.18666 WP_000394983.1.1867 WP_000394983.1.18675 WP_000394983.1.18699 WP_000394983.1.18714 WP_000394983.1.18725 WP_000394983.1.1873 WP_000394983.1.18794 WP_000394983.1.188 WP_000394983.1.18802 WP_000394983.1.18828 WP_000394983.1.18837 WP_000394983.1.18843 WP_000394983.1.18858 WP_000394983.1.18861 WP_000394983.1.18874 WP_000394983.1.18876 WP_000394983.1.18899 WP_000394983.1.18908 WP_000394983.1.18923 WP_000394983.1.18929 WP_000394983.1.18934 WP_000394983.1.18936 WP_000394983.1.1896 WP_000394983.1.18962 WP_000394983.1.18966 WP_000394983.1.18983 WP_000394983.1.18995 WP_000394983.1.1903 WP_000394983.1.19036 WP_000394983.1.19039 WP_000394983.1.1906 WP_000394983.1.19075 WP_000394983.1.1909 WP_000394983.1.191 WP_000394983.1.19100 WP_000394983.1.19114 WP_000394983.1.19135 WP_000394983.1.19146 WP_000394983.1.19147 WP_000394983.1.1915 WP_000394983.1.19150 WP_000394983.1.19153 WP_000394983.1.19171 WP_000394983.1.19194 WP_000394983.1.19205 WP_000394983.1.19206 WP_000394983.1.19245 WP_000394983.1.1925 WP_000394983.1.19276 WP_000394983.1.19277 WP_000394983.1.19297 WP_000394983.1.193 WP_000394983.1.19312 WP_000394983.1.19313 WP_000394983.1.19314 WP_000394983.1.19315 WP_000394983.1.19332 WP_000394983.1.19347 WP_000394983.1.19350 WP_000394983.1.19361 WP_000394983.1.19374 WP_000394983.1.19379 WP_000394983.1.19389 WP_000394983.1.19397 WP_000394983.1.19419 WP_000394983.1.19424 WP_000394983.1.19441 WP_000394983.1.19448 WP_000394983.1.19478 WP_000394983.1.19492 WP_000394983.1.19494 WP_000394983.1.1952 WP_000394983.1.19534 WP_000394983.1.19544 WP_000394983.1.19547 WP_000394983.1.19557 WP_000394983.1.19581 WP_000394983.1.19583 WP_000394983.1.19593 WP_000394983.1.1960 WP_000394983.1.19602 WP_000394983.1.1963 WP_000394983.1.19644 WP_000394983.1.19654 WP_000394983.1.19655 WP_000394983.1.19661 WP_000394983.1.19691 WP_000394983.1.19761 WP_000394983.1.19778 WP_000394983.1.19795 WP_000394983.1.1982 WP_000394983.1.19830 WP_000394983.1.19840 WP_000394983.1.19847 WP_000394983.1.19861 WP_000394983.1.1987 WP_000394983.1.19878 WP_000394983.1.19889 WP_000394983.1.19940 WP_000394983.1.19957 WP_000394983.1.19972 WP_000394983.1.19994 WP_000394983.1.2005 WP_000394983.1.20114 WP_000394983.1.20115 WP_000394983.1.20129 WP_000394983.1.2015 WP_000394983.1.20157 WP_000394983.1.20159 WP_000394983.1.20164 WP_000394983.1.20166 WP_000394983.1.20170 WP_000394983.1.20178 WP_000394983.1.20183 WP_000394983.1.20215 WP_000394983.1.20238 WP_000394983.1.20251 WP_000394983.1.20264 WP_000394983.1.2027 WP_000394983.1.20289 WP_000394983.1.20308 WP_000394983.1.20325 WP_000394983.1.20331 WP_000394983.1.20334 WP_000394983.1.20445 WP_000394983.1.20449 WP_000394983.1.20452 WP_000394983.1.20480 WP_000394983.1.20483 WP_000394983.1.20493 WP_000394983.1.20515 WP_000394983.1.20519 WP_000394983.1.20536 WP_000394983.1.20549 WP_000394983.1.20575 WP_000394983.1.20609 WP_000394983.1.2063 WP_000394983.1.20640 WP_000394983.1.20662 WP_000394983.1.20709 WP_000394983.1.20730 WP_000394983.1.20737 WP_000394983.1.20741 WP_000394983.1.2075 WP_000394983.1.20761 WP_000394983.1.20765 WP_000394983.1.20784 WP_000394983.1.20785 WP_000394983.1.20803 WP_000394983.1.20813 WP_000394983.1.20818 WP_000394983.1.20824 WP_000394983.1.20848 WP_000394983.1.2089 WP_000394983.1.20893 WP_000394983.1.20933 WP_000394983.1.2094 WP_000394983.1.20941 WP_000394983.1.20943 WP_000394983.1.20950 WP_000394983.1.20958 WP_000394983.1.20962 WP_000394983.1.20982 WP_000394983.1.20989 WP_000394983.1.2100 WP_000394983.1.21017 WP_000394983.1.21020 WP_000394983.1.21033 WP_000394983.1.21041 WP_000394983.1.21057 WP_000394983.1.21122 WP_000394983.1.21137 WP_000394983.1.21152 WP_000394983.1.21251 WP_000394983.1.21255 WP_000394983.1.21266 WP_000394983.1.21277 WP_000394983.1.21320 WP_000394983.1.21336 WP_000394983.1.21378 WP_000394983.1.2142 WP_000394983.1.21441 WP_000394983.1.21455 WP_000394983.1.21470 WP_000394983.1.21508 WP_000394983.1.21519 WP_000394983.1.21526 WP_000394983.1.21537 WP_000394983.1.2156 WP_000394983.1.21573 WP_000394983.1.21578 WP_000394983.1.21596 WP_000394983.1.21614 WP_000394983.1.21628 WP_000394983.1.21634 WP_000394983.1.21637 WP_000394983.1.2164 WP_000394983.1.21656 WP_000394983.1.21661 WP_000394983.1.21666 WP_000394983.1.21667 WP_000394983.1.21668 WP_000394983.1.21714 WP_000394983.1.21729 WP_000394983.1.21732 WP_000394983.1.21733 WP_000394983.1.21756 WP_000394983.1.21758 WP_000394983.1.21771 WP_000394983.1.21812 WP_000394983.1.21823 WP_000394983.1.21887 WP_000394983.1.21895 WP_000394983.1.21899 WP_000394983.1.21915 WP_000394983.1.21948 WP_000394983.1.21962 WP_000394983.1.2198 WP_000394983.1.21986 WP_000394983.1.21992 WP_000394983.1.22042 WP_000394983.1.22060 WP_000394983.1.22088 WP_000394983.1.22113 WP_000394983.1.22138 WP_000394983.1.22161 WP_000394983.1.2218 WP_000394983.1.22203 WP_000394983.1.22204 WP_000394983.1.22251 WP_000394983.1.22269 WP_000394983.1.22272 WP_000394983.1.22280 WP_000394983.1.22291 WP_000394983.1.22293 WP_000394983.1.22304 WP_000394983.1.22314 WP_000394983.1.22325 WP_000394983.1.22350 WP_000394983.1.22359 WP_000394983.1.22363 WP_000394983.1.22381 WP_000394983.1.2242 WP_000394983.1.2245 WP_000394983.1.22450 WP_000394983.1.22464 WP_000394983.1.22494 WP_000394983.1.22508 WP_000394983.1.22543 WP_000394983.1.22544 WP_000394983.1.22549 WP_000394983.1.22571 WP_000394983.1.22572 WP_000394983.1.22574 WP_000394983.1.22576 WP_000394983.1.22579 WP_000394983.1.22594 WP_000394983.1.22602 WP_000394983.1.22631 WP_000394983.1.22632 WP_000394983.1.22649 WP_000394983.1.22662 WP_000394983.1.22667 WP_000394983.1.22669 WP_000394983.1.22690 WP_000394983.1.22691 WP_000394983.1.22756 WP_000394983.1.22757 WP_000394983.1.22759 WP_000394983.1.22765 WP_000394983.1.22777 WP_000394983.1.22783 WP_000394983.1.22814 WP_000394983.1.22824 WP_000394983.1.22830 WP_000394983.1.22868 WP_000394983.1.22875 WP_000394983.1.22885 WP_000394983.1.22917 WP_000394983.1.22925 WP_000394983.1.22939 WP_000394983.1.22988 WP_000394983.1.22993 WP_000394983.1.2300 WP_000394983.1.23005 WP_000394983.1.23021 WP_000394983.1.23026 WP_000394983.1.23035 WP_000394983.1.23042 WP_000394983.1.23044 WP_000394983.1.23045 WP_000394983.1.23073 WP_000394983.1.23078 WP_000394983.1.23090 WP_000394983.1.23092 WP_000394983.1.23109 WP_000394983.1.23115 WP_000394983.1.2322 WP_000394983.1.23230 WP_000394983.1.23241 WP_000394983.1.23282 WP_000394983.1.23285 WP_000394983.1.23290 WP_000394983.1.23323 WP_000394983.1.23330 WP_000394983.1.23355 WP_000394983.1.23376 WP_000394983.1.23378 WP_000394983.1.23383 WP_000394983.1.23393 WP_000394983.1.23435 WP_000394983.1.23463 WP_000394983.1.23467 WP_000394983.1.23486 WP_000394983.1.23487 WP_000394983.1.23511 WP_000394983.1.23522 WP_000394983.1.23549 WP_000394983.1.23575 WP_000394983.1.23593 WP_000394983.1.2362 WP_000394983.1.23625 WP_000394983.1.23640 WP_000394983.1.23676 WP_000394983.1.23686 WP_000394983.1.23693 WP_000394983.1.23700 WP_000394983.1.23711 WP_000394983.1.23724 WP_000394983.1.23741 WP_000394983.1.23752 WP_000394983.1.23754 WP_000394983.1.23765 WP_000394983.1.23790 WP_000394983.1.23806 WP_000394983.1.23812 WP_000394983.1.23838 WP_000394983.1.23840 WP_000394983.1.23855 WP_000394983.1.23869 WP_000394983.1.2388 WP_000394983.1.23890 WP_000394983.1.23895 WP_000394983.1.23898 WP_000394983.1.23899 WP_000394983.1.23914 WP_000394983.1.23945 WP_000394983.1.23953 WP_000394983.1.23960 WP_000394983.1.23962 WP_000394983.1.23973 WP_000394983.1.23984 WP_000394983.1.23985 WP_000394983.1.24004 WP_000394983.1.24024 WP_000394983.1.24038 WP_000394983.1.24045 WP_000394983.1.24068 WP_000394983.1.24070 WP_000394983.1.24088 WP_000394983.1.24089 WP_000394983.1.24122 WP_000394983.1.24124 WP_000394983.1.24127 WP_000394983.1.2413 WP_000394983.1.24136 WP_000394983.1.24169 WP_000394983.1.24177 WP_000394983.1.2418 WP_000394983.1.24194 WP_000394983.1.24278 WP_000394983.1.2428 WP_000394983.1.24283 WP_000394983.1.2430 WP_000394983.1.24316 WP_000394983.1.24362 WP_000394983.1.24374 WP_000394983.1.24381 WP_000394983.1.24383 WP_000394983.1.24458 WP_000394983.1.24460 WP_000394983.1.24473 WP_000394983.1.24483 WP_000394983.1.24485 WP_000394983.1.2449 WP_000394983.1.24499 WP_000394983.1.24524 WP_000394983.1.24575 WP_000394983.1.24577 WP_000394983.1.24583 WP_000394983.1.24616 WP_000394983.1.24634 WP_000394983.1.24641 WP_000394983.1.24646 WP_000394983.1.24650 WP_000394983.1.2469 WP_000394983.1.24695 WP_000394983.1.24703 WP_000394983.1.24753 WP_000394983.1.24758 WP_000394983.1.24773 WP_000394983.1.24797 WP_000394983.1.24849 WP_000394983.1.24854 WP_000394983.1.24870 WP_000394983.1.24899 WP_000394983.1.24906 WP_000394983.1.24909 WP_000394983.1.24926 WP_000394983.1.24939 WP_000394983.1.24946 WP_000394983.1.24968 WP_000394983.1.24979 WP_000394983.1.24984 WP_000394983.1.25019 WP_000394983.1.2502 WP_000394983.1.25021 WP_000394983.1.25039 WP_000394983.1.2504 WP_000394983.1.25042 WP_000394983.1.25050 WP_000394983.1.25076 WP_000394983.1.25079 WP_000394983.1.25085 WP_000394983.1.25086 WP_000394983.1.25088 WP_000394983.1.2512 WP_000394983.1.25126 WP_000394983.1.25141 WP_000394983.1.25174 WP_000394983.1.25183 WP_000394983.1.25193 WP_000394983.1.25201 WP_000394983.1.25203 WP_000394983.1.25204 WP_000394983.1.25248 WP_000394983.1.25270 WP_000394983.1.25305 WP_000394983.1.2531 WP_000394983.1.25312 WP_000394983.1.2537 WP_000394983.1.25378 WP_000394983.1.25380 WP_000394983.1.2540 WP_000394983.1.25414 WP_000394983.1.25420 WP_000394983.1.2543 WP_000394983.1.25446 WP_000394983.1.25480 WP_000394983.1.255 WP_000394983.1.25526 WP_000394983.1.25548 WP_000394983.1.25577 WP_000394983.1.2558 WP_000394983.1.25592 WP_000394983.1.25612 WP_000394983.1.25613 WP_000394983.1.25631 WP_000394983.1.25643 WP_000394983.1.25652 WP_000394983.1.2567 WP_000394983.1.25680 WP_000394983.1.25701 WP_000394983.1.25712 WP_000394983.1.25713 WP_000394983.1.25724 WP_000394983.1.25750 WP_000394983.1.25755 WP_000394983.1.25794 WP_000394983.1.25819 WP_000394983.1.25831 WP_000394983.1.25832 WP_000394983.1.25843 WP_000394983.1.25869 WP_000394983.1.25873 WP_000394983.1.25886 WP_000394983.1.25890 WP_000394983.1.25895 WP_000394983.1.25945 WP_000394983.1.25996 WP_000394983.1.26040 WP_000394983.1.26048 WP_000394983.1.26055 WP_000394983.1.2606 WP_000394983.1.26066 WP_000394983.1.26076 WP_000394983.1.26092 WP_000394983.1.26100 WP_000394983.1.26105 WP_000394983.1.2612 WP_000394983.1.26121 WP_000394983.1.26130 WP_000394983.1.26134 WP_000394983.1.26150 WP_000394983.1.26161 WP_000394983.1.26175 WP_000394983.1.26186 WP_000394983.1.26189 WP_000394983.1.26191 WP_000394983.1.26196 WP_000394983.1.26246 WP_000394983.1.26259 WP_000394983.1.26262 WP_000394983.1.26264 WP_000394983.1.26270 WP_000394983.1.26284 WP_000394983.1.26304 WP_000394983.1.26325 WP_000394983.1.2637 WP_000394983.1.26379 WP_000394983.1.26391 WP_000394983.1.26398 WP_000394983.1.26401 WP_000394983.1.26403 WP_000394983.1.2642 WP_000394983.1.26467 WP_000394983.1.26474 WP_000394983.1.26479 WP_000394983.1.26480 WP_000394983.1.26517 WP_000394983.1.26525 WP_000394983.1.26569 WP_000394983.1.26574 WP_000394983.1.26575 WP_000394983.1.26579 WP_000394983.1.26588 WP_000394983.1.26590 WP_000394983.1.26598 WP_000394983.1.26609 WP_000394983.1.26613 WP_000394983.1.26627 WP_000394983.1.26644 WP_000394983.1.2665 WP_000394983.1.26659 WP_000394983.1.26660 WP_000394983.1.26683 WP_000394983.1.26688 WP_000394983.1.26716 WP_000394983.1.26720 WP_000394983.1.26761 WP_000394983.1.26782 WP_000394983.1.26837 WP_000394983.1.26839 WP_000394983.1.26861 WP_000394983.1.26878 WP_000394983.1.2688 WP_000394983.1.26912 WP_000394983.1.26932 WP_000394983.1.26941 WP_000394983.1.26943 WP_000394983.1.2695 WP_000394983.1.26950 WP_000394983.1.26975 WP_000394983.1.26987 WP_000394983.1.26995 WP_000394983.1.26998 WP_000394983.1.2700 WP_000394983.1.27019 WP_000394983.1.27043 WP_000394983.1.27057 WP_000394983.1.27060 WP_000394983.1.27091 WP_000394983.1.27098 WP_000394983.1.27101 WP_000394983.1.27134 WP_000394983.1.27141 WP_000394983.1.27148 WP_000394983.1.27175 WP_000394983.1.27188 WP_000394983.1.27214 WP_000394983.1.27234 WP_000394983.1.27260 WP_000394983.1.27280 WP_000394983.1.27283 WP_000394983.1.27287 WP_000394983.1.27292 WP_000394983.1.2731 WP_000394983.1.27310 WP_000394983.1.27330 WP_000394983.1.27338 WP_000394983.1.27367 WP_000394983.1.27373 WP_000394983.1.27396 WP_000394983.1.27401 WP_000394983.1.27424 WP_000394983.1.27445 WP_000394983.1.2745 WP_000394983.1.27451 WP_000394983.1.27504 WP_000394983.1.27518 WP_000394983.1.27520 WP_000394983.1.27524 WP_000394983.1.27560 WP_000394983.1.27580 WP_000394983.1.27611 WP_000394983.1.27618 WP_000394983.1.27698 WP_000394983.1.27723 WP_000394983.1.27741 WP_000394983.1.27742 WP_000394983.1.27749 WP_000394983.1.27758 WP_000394983.1.27774 WP_000394983.1.2779 WP_000394983.1.2782 WP_000394983.1.27846 WP_000394983.1.27856 WP_000394983.1.27871 WP_000394983.1.27876 WP_000394983.1.27879 WP_000394983.1.27897 WP_000394983.1.27913 WP_000394983.1.27923 WP_000394983.1.27932 WP_000394983.1.2794 WP_000394983.1.27971 WP_000394983.1.27998 WP_000394983.1.28008 WP_000394983.1.28026 WP_000394983.1.28051 WP_000394983.1.2811 WP_000394983.1.28110 WP_000394983.1.28145 WP_000394983.1.28156 WP_000394983.1.28199 WP_000394983.1.28250 WP_000394983.1.2826 WP_000394983.1.28268 WP_000394983.1.28271 WP_000394983.1.28314 WP_000394983.1.28318 WP_000394983.1.28345 WP_000394983.1.28349 WP_000394983.1.28371 WP_000394983.1.2838 WP_000394983.1.28461 WP_000394983.1.28476 WP_000394983.1.28480 WP_000394983.1.28496 WP_000394983.1.285 WP_000394983.1.28500 WP_000394983.1.28509 WP_000394983.1.28523 WP_000394983.1.28540 WP_000394983.1.28551 WP_000394983.1.28554 WP_000394983.1.28568 WP_000394983.1.28639 WP_000394983.1.2866 WP_000394983.1.28662 WP_000394983.1.28683 WP_000394983.1.28697 WP_000394983.1.28711 WP_000394983.1.28723 WP_000394983.1.28732 WP_000394983.1.28736 WP_000394983.1.28742 WP_000394983.1.28762 WP_000394983.1.28809 WP_000394983.1.2881 WP_000394983.1.28829 WP_000394983.1.28842 WP_000394983.1.28879 WP_000394983.1.28919 WP_000394983.1.28924 WP_000394983.1.28950 WP_000394983.1.28953 WP_000394983.1.28982 WP_000394983.1.28994 WP_000394983.1.290 WP_000394983.1.29001 WP_000394983.1.29013 WP_000394983.1.29016 WP_000394983.1.29026 WP_000394983.1.29055 WP_000394983.1.29061 WP_000394983.1.29082 WP_000394983.1.291 WP_000394983.1.29100 WP_000394983.1.29118 WP_000394983.1.29125 WP_000394983.1.29126 WP_000394983.1.29128 WP_000394983.1.29164 WP_000394983.1.29176 WP_000394983.1.29194 WP_000394983.1.29202 WP_000394983.1.29206 WP_000394983.1.29221 WP_000394983.1.29230 WP_000394983.1.29239 WP_000394983.1.29252 WP_000394983.1.29258 WP_000394983.1.2926 WP_000394983.1.29341 WP_000394983.1.29377 WP_000394983.1.29404 WP_000394983.1.2942 WP_000394983.1.29429 WP_000394983.1.29443 WP_000394983.1.2945 WP_000394983.1.29495 WP_000394983.1.29503 WP_000394983.1.29504 WP_000394983.1.29513 WP_000394983.1.2952 WP_000394983.1.29523 WP_000394983.1.29564 WP_000394983.1.29590 WP_000394983.1.29597 WP_000394983.1.29603 WP_000394983.1.29618 WP_000394983.1.2963 WP_000394983.1.29647 WP_000394983.1.29662 WP_000394983.1.29669 WP_000394983.1.29683 WP_000394983.1.29689 WP_000394983.1.29715 WP_000394983.1.29746 WP_000394983.1.29752 WP_000394983.1.2978 WP_000394983.1.29798 WP_000394983.1.29812 WP_000394983.1.29815 WP_000394983.1.29818 WP_000394983.1.29819 WP_000394983.1.29820 WP_000394983.1.29821 WP_000394983.1.29840 WP_000394983.1.29855 WP_000394983.1.29874 WP_000394983.1.29876 WP_000394983.1.29884 WP_000394983.1.29967 WP_000394983.1.29988 WP_000394983.1.29992 WP_000394983.1.30 WP_000394983.1.30004 WP_000394983.1.30019 WP_000394983.1.30035 WP_000394983.1.30052 WP_000394983.1.30063 WP_000394983.1.30064 WP_000394983.1.30105 WP_000394983.1.30123 WP_000394983.1.30164 WP_000394983.1.3018 WP_000394983.1.30231 WP_000394983.1.30232 WP_000394983.1.30239 WP_000394983.1.30247 WP_000394983.1.30253 WP_000394983.1.30269 WP_000394983.1.30298 WP_000394983.1.30391 WP_000394983.1.30397 WP_000394983.1.30399 WP_000394983.1.30400 WP_000394983.1.30428 WP_000394983.1.30447 WP_000394983.1.3045 WP_000394983.1.30452 WP_000394983.1.30476 WP_000394983.1.30479 WP_000394983.1.30497 WP_000394983.1.30524 WP_000394983.1.30536 WP_000394983.1.30546 WP_000394983.1.30550 WP_000394983.1.30554 WP_000394983.1.30580 WP_000394983.1.3063 WP_000394983.1.30630 WP_000394983.1.30637 WP_000394983.1.30639 WP_000394983.1.30658 WP_000394983.1.30665 WP_000394983.1.30691 WP_000394983.1.30733 WP_000394983.1.30742 WP_000394983.1.30749 WP_000394983.1.30762 WP_000394983.1.3083 WP_000394983.1.30853 WP_000394983.1.30867 WP_000394983.1.30879 WP_000394983.1.30896 WP_000394983.1.309 WP_000394983.1.30905 WP_000394983.1.30906 WP_000394983.1.30918 WP_000394983.1.30987 WP_000394983.1.30993 WP_000394983.1.30999 WP_000394983.1.31000 WP_000394983.1.31009 WP_000394983.1.31017 WP_000394983.1.31029 WP_000394983.1.31055 WP_000394983.1.31083 WP_000394983.1.31089 WP_000394983.1.31119 WP_000394983.1.31129 WP_000394983.1.31142 WP_000394983.1.31149 WP_000394983.1.31154 WP_000394983.1.312 WP_000394983.1.31211 WP_000394983.1.31252 WP_000394983.1.31295 WP_000394983.1.31340 WP_000394983.1.31347 WP_000394983.1.31357 WP_000394983.1.31379 WP_000394983.1.3140 WP_000394983.1.31401 WP_000394983.1.31407 WP_000394983.1.31419 WP_000394983.1.31421 WP_000394983.1.31422 WP_000394983.1.31433 WP_000394983.1.3147 WP_000394983.1.31506 WP_000394983.1.31511 WP_000394983.1.31518 WP_000394983.1.31521 WP_000394983.1.31542 WP_000394983.1.31557 WP_000394983.1.31559 WP_000394983.1.31575 WP_000394983.1.31596 WP_000394983.1.31614 WP_000394983.1.31639 WP_000394983.1.31657 WP_000394983.1.31675 WP_000394983.1.31679 WP_000394983.1.31681 WP_000394983.1.3169 WP_000394983.1.31709 WP_000394983.1.31740 WP_000394983.1.31803 WP_000394983.1.31809 WP_000394983.1.3181 WP_000394983.1.31823 WP_000394983.1.31825 WP_000394983.1.31833 WP_000394983.1.31835 WP_000394983.1.31839 WP_000394983.1.31860 WP_000394983.1.31863 WP_000394983.1.31866 WP_000394983.1.31898 WP_000394983.1.31924 WP_000394983.1.31928 WP_000394983.1.3193 WP_000394983.1.31956 WP_000394983.1.31978 WP_000394983.1.3201 WP_000394983.1.32020 WP_000394983.1.32021 WP_000394983.1.32024 WP_000394983.1.32063 WP_000394983.1.32089 WP_000394983.1.32091 WP_000394983.1.32093 WP_000394983.1.32094 WP_000394983.1.3212 WP_000394983.1.32121 WP_000394983.1.32127 WP_000394983.1.32138 WP_000394983.1.32143 WP_000394983.1.3215 WP_000394983.1.32173 WP_000394983.1.32184 WP_000394983.1.322 WP_000394983.1.32225 WP_000394983.1.32232 WP_000394983.1.32234 WP_000394983.1.32243 WP_000394983.1.32279 WP_000394983.1.32287 WP_000394983.1.3233 WP_000394983.1.32394 WP_000394983.1.32406 WP_000394983.1.32432 WP_000394983.1.3247 WP_000394983.1.32475 WP_000394983.1.32478 WP_000394983.1.32479 WP_000394983.1.3248 WP_000394983.1.32494 WP_000394983.1.32518 WP_000394983.1.32536 WP_000394983.1.32561 WP_000394983.1.32574 WP_000394983.1.32580 WP_000394983.1.32587 WP_000394983.1.3259 WP_000394983.1.32590 WP_000394983.1.32635 WP_000394983.1.32650 WP_000394983.1.32655 WP_000394983.1.32661 WP_000394983.1.32676 WP_000394983.1.32680 WP_000394983.1.3269 WP_000394983.1.32709 WP_000394983.1.32718 WP_000394983.1.32720 WP_000394983.1.32722 WP_000394983.1.32724 WP_000394983.1.32748 WP_000394983.1.32811 WP_000394983.1.32815 WP_000394983.1.32831 WP_000394983.1.32835 WP_000394983.1.32875 WP_000394983.1.32888 WP_000394983.1.32903 WP_000394983.1.32910 WP_000394983.1.32931 WP_000394983.1.32938 WP_000394983.1.32946 WP_000394983.1.3295 WP_000394983.1.32959 WP_000394983.1.32972 WP_000394983.1.32984 WP_000394983.1.32992 WP_000394983.1.32995 WP_000394983.1.33004 WP_000394983.1.33014 WP_000394983.1.33018 WP_000394983.1.33022 WP_000394983.1.33046 WP_000394983.1.33049 WP_000394983.1.33053 WP_000394983.1.33055 WP_000394983.1.33094 WP_000394983.1.33101 WP_000394983.1.33119 WP_000394983.1.33146 WP_000394983.1.33167 WP_000394983.1.33178 WP_000394983.1.33179 WP_000394983.1.33190 WP_000394983.1.33217 WP_000394983.1.3323 WP_000394983.1.33238 WP_000394983.1.33244 WP_000394983.1.33268 WP_000394983.1.33303 WP_000394983.1.33325 WP_000394983.1.33341 WP_000394983.1.33352 WP_000394983.1.33369 WP_000394983.1.33385 WP_000394983.1.334 WP_000394983.1.33408 WP_000394983.1.33410 WP_000394983.1.33422 WP_000394983.1.33424 WP_000394983.1.33428 WP_000394983.1.3344 WP_000394983.1.33475 WP_000394983.1.33476 WP_000394983.1.33502 WP_000394983.1.33512 WP_000394983.1.33525 WP_000394983.1.33526 WP_000394983.1.3354 WP_000394983.1.33545 WP_000394983.1.33563 WP_000394983.1.33565 WP_000394983.1.33584 WP_000394983.1.33595 WP_000394983.1.33631 WP_000394983.1.33638 WP_000394983.1.33648 WP_000394983.1.33680 WP_000394983.1.33736 WP_000394983.1.33745 WP_000394983.1.33746 WP_000394983.1.33751 WP_000394983.1.33799 WP_000394983.1.33853 WP_000394983.1.33879 WP_000394983.1.33888 WP_000394983.1.33914 WP_000394983.1.33948 WP_000394983.1.33952 WP_000394983.1.33973 WP_000394983.1.33974 WP_000394983.1.33979 WP_000394983.1.3398 WP_000394983.1.33981 WP_000394983.1.3401 WP_000394983.1.34032 WP_000394983.1.3411 WP_000394983.1.34117 WP_000394983.1.34122 WP_000394983.1.34124 WP_000394983.1.34130 WP_000394983.1.34144 WP_000394983.1.342 WP_000394983.1.34204 WP_000394983.1.34206 WP_000394983.1.34208 WP_000394983.1.34224 WP_000394983.1.34269 WP_000394983.1.34270 WP_000394983.1.34273 WP_000394983.1.34294 WP_000394983.1.34303 WP_000394983.1.3432 WP_000394983.1.34332 WP_000394983.1.34341 WP_000394983.1.34348 WP_000394983.1.34362 WP_000394983.1.34363 WP_000394983.1.34383 WP_000394983.1.3439 WP_000394983.1.34397 WP_000394983.1.34400 WP_000394983.1.3444 WP_000394983.1.34440 WP_000394983.1.34441 WP_000394983.1.34444 WP_000394983.1.34464 WP_000394983.1.34500 WP_000394983.1.34525 WP_000394983.1.34528 WP_000394983.1.34532 WP_000394983.1.34538 WP_000394983.1.34558 WP_000394983.1.3460 WP_000394983.1.34605 WP_000394983.1.34617 WP_000394983.1.34675 WP_000394983.1.34680 WP_000394983.1.34682 WP_000394983.1.34683 WP_000394983.1.34686 WP_000394983.1.3469 WP_000394983.1.347 WP_000394983.1.3472 WP_000394983.1.34727 WP_000394983.1.34763 WP_000394983.1.34781 WP_000394983.1.34782 WP_000394983.1.34794 WP_000394983.1.34827 WP_000394983.1.34835 WP_000394983.1.34838 WP_000394983.1.34855 WP_000394983.1.34875 WP_000394983.1.34887 WP_000394983.1.34913 WP_000394983.1.34931 WP_000394983.1.34948 WP_000394983.1.34982 WP_000394983.1.34990 WP_000394983.1.34993 WP_000394983.1.35006 WP_000394983.1.35007 WP_000394983.1.35012 WP_000394983.1.35107 WP_000394983.1.35114 WP_000394983.1.35127 WP_000394983.1.35132 WP_000394983.1.3515 WP_000394983.1.35168 WP_000394983.1.35186 WP_000394983.1.35195 WP_000394983.1.35198 WP_000394983.1.35204 WP_000394983.1.35211 WP_000394983.1.35220 WP_000394983.1.35253 WP_000394983.1.35258 WP_000394983.1.35316 WP_000394983.1.35328 WP_000394983.1.35360 WP_000394983.1.35365 WP_000394983.1.35376 WP_000394983.1.3539 WP_000394983.1.35393 WP_000394983.1.35394 WP_000394983.1.35398 WP_000394983.1.35464 WP_000394983.1.35465 WP_000394983.1.35466 WP_000394983.1.35483 WP_000394983.1.3550 WP_000394983.1.35552 WP_000394983.1.35578 WP_000394983.1.3560 WP_000394983.1.35604 WP_000394983.1.35627 WP_000394983.1.35632 WP_000394983.1.35653 WP_000394983.1.35704 WP_000394983.1.35724 WP_000394983.1.35740 WP_000394983.1.35741 WP_000394983.1.35744 WP_000394983.1.35889 WP_000394983.1.35904 WP_000394983.1.35922 WP_000394983.1.35927 WP_000394983.1.35934 WP_000394983.1.35942 WP_000394983.1.35959 WP_000394983.1.35963 WP_000394983.1.35987 WP_000394983.1.35990 WP_000394983.1.3600 WP_000394983.1.36010 WP_000394983.1.36040 WP_000394983.1.36042 WP_000394983.1.36070 WP_000394983.1.36071 WP_000394983.1.36085 WP_000394983.1.36094 WP_000394983.1.36105 WP_000394983.1.36132 WP_000394983.1.36158 WP_000394983.1.36164 WP_000394983.1.36166 WP_000394983.1.36177 WP_000394983.1.36182 WP_000394983.1.3620 WP_000394983.1.36207 WP_000394983.1.36212 WP_000394983.1.3624 WP_000394983.1.36334 WP_000394983.1.36352 WP_000394983.1.36386 WP_000394983.1.36405 WP_000394983.1.36412 WP_000394983.1.36414 WP_000394983.1.36426 WP_000394983.1.3643 WP_000394983.1.36459 WP_000394983.1.36496 WP_000394983.1.365 WP_000394983.1.36500 WP_000394983.1.36507 WP_000394983.1.36545 WP_000394983.1.36610 WP_000394983.1.36626 WP_000394983.1.36627 WP_000394983.1.36628 WP_000394983.1.36667 WP_000394983.1.3668 WP_000394983.1.36699 WP_000394983.1.36707 WP_000394983.1.36724 WP_000394983.1.36739 WP_000394983.1.36746 WP_000394983.1.36747 WP_000394983.1.36761 WP_000394983.1.36767 WP_000394983.1.36799 WP_000394983.1.36812 WP_000394983.1.36817 WP_000394983.1.36826 WP_000394983.1.36833 WP_000394983.1.36886 WP_000394983.1.36925 WP_000394983.1.3697 WP_000394983.1.36975 WP_000394983.1.37006 WP_000394983.1.37032 WP_000394983.1.37046 WP_000394983.1.37049 WP_000394983.1.37057 WP_000394983.1.37099 WP_000394983.1.37102 WP_000394983.1.37103 WP_000394983.1.37122 WP_000394983.1.37146 WP_000394983.1.37153 WP_000394983.1.37206 WP_000394983.1.3723 WP_000394983.1.37233 WP_000394983.1.37252 WP_000394983.1.37261 WP_000394983.1.37266 WP_000394983.1.37290 WP_000394983.1.37306 WP_000394983.1.37313 WP_000394983.1.37329 WP_000394983.1.37334 WP_000394983.1.37337 WP_000394983.1.37342 WP_000394983.1.37352 WP_000394983.1.37360 WP_000394983.1.37371 WP_000394983.1.37372 WP_000394983.1.37388 WP_000394983.1.37419 WP_000394983.1.37423 WP_000394983.1.37433 WP_000394983.1.37445 WP_000394983.1.37472 WP_000394983.1.37476 WP_000394983.1.37477 WP_000394983.1.37485 WP_000394983.1.37510 WP_000394983.1.37516 WP_000394983.1.37538 WP_000394983.1.37544 WP_000394983.1.37548 WP_000394983.1.37550 WP_000394983.1.37554 WP_000394983.1.37576 WP_000394983.1.37588 WP_000394983.1.37592 WP_000394983.1.37608 WP_000394983.1.3762 WP_000394983.1.37634 WP_000394983.1.37664 WP_000394983.1.377 WP_000394983.1.3772 WP_000394983.1.37731 WP_000394983.1.37736 WP_000394983.1.37745 WP_000394983.1.37750 WP_000394983.1.37758 WP_000394983.1.37762 WP_000394983.1.37766 WP_000394983.1.37769 WP_000394983.1.37773 WP_000394983.1.37852 WP_000394983.1.37853 WP_000394983.1.3788 WP_000394983.1.37880 WP_000394983.1.37887 WP_000394983.1.37897 WP_000394983.1.37917 WP_000394983.1.37926 WP_000394983.1.3795 WP_000394983.1.3796 WP_000394983.1.37962 WP_000394983.1.37964 WP_000394983.1.37984 WP_000394983.1.37995 WP_000394983.1.37998 WP_000394983.1.38000 WP_000394983.1.38033 WP_000394983.1.38050 WP_000394983.1.38063 WP_000394983.1.38080 WP_000394983.1.38081 WP_000394983.1.38085 WP_000394983.1.38103 WP_000394983.1.38105 WP_000394983.1.38107 WP_000394983.1.3811 WP_000394983.1.38120 WP_000394983.1.3815 WP_000394983.1.38155 WP_000394983.1.38182 WP_000394983.1.38185 WP_000394983.1.38194 WP_000394983.1.38211 WP_000394983.1.38234 WP_000394983.1.38257 WP_000394983.1.38293 WP_000394983.1.38300 WP_000394983.1.38323 WP_000394983.1.38357 WP_000394983.1.38363 WP_000394983.1.38369 WP_000394983.1.38371 WP_000394983.1.38392 WP_000394983.1.38412 WP_000394983.1.38485 WP_000394983.1.38533 WP_000394983.1.38544 WP_000394983.1.38561 WP_000394983.1.38584 WP_000394983.1.38626 WP_000394983.1.38629 WP_000394983.1.38636 WP_000394983.1.38694 WP_000394983.1.38722 WP_000394983.1.3873 WP_000394983.1.38751 WP_000394983.1.38777 WP_000394983.1.38811 WP_000394983.1.38827 WP_000394983.1.38835 WP_000394983.1.38843 WP_000394983.1.38896 WP_000394983.1.389 WP_000394983.1.38911 WP_000394983.1.38935 WP_000394983.1.38937 WP_000394983.1.38950 WP_000394983.1.38958 WP_000394983.1.39005 WP_000394983.1.39037 WP_000394983.1.3904 WP_000394983.1.39103 WP_000394983.1.39123 WP_000394983.1.39148 WP_000394983.1.39150 WP_000394983.1.39155 WP_000394983.1.39164 WP_000394983.1.39167 WP_000394983.1.39171 WP_000394983.1.39180 WP_000394983.1.39184 WP_000394983.1.39196 WP_000394983.1.39209 WP_000394983.1.3921 WP_000394983.1.3922 WP_000394983.1.39232 WP_000394983.1.39249 WP_000394983.1.39254 WP_000394983.1.39268 WP_000394983.1.39289 WP_000394983.1.39302 WP_000394983.1.39305 WP_000394983.1.39310 WP_000394983.1.39313 WP_000394983.1.39325 WP_000394983.1.39327 WP_000394983.1.39335 WP_000394983.1.39342 WP_000394983.1.39356 WP_000394983.1.39365 WP_000394983.1.39367 WP_000394983.1.39401 WP_000394983.1.39423 WP_000394983.1.39430 WP_000394983.1.39481 WP_000394983.1.39509 WP_000394983.1.3954 WP_000394983.1.39541 WP_000394983.1.39564 WP_000394983.1.39601 WP_000394983.1.39607 WP_000394983.1.39626 WP_000394983.1.39636 WP_000394983.1.39651 WP_000394983.1.39690 WP_000394983.1.3970 WP_000394983.1.39708 WP_000394983.1.39709 WP_000394983.1.39713 WP_000394983.1.39715 WP_000394983.1.39717 WP_000394983.1.39726 WP_000394983.1.39733 WP_000394983.1.39734 WP_000394983.1.39758 WP_000394983.1.39780 WP_000394983.1.3980 WP_000394983.1.39809 WP_000394983.1.39820 WP_000394983.1.39822 WP_000394983.1.39829 WP_000394983.1.39867 WP_000394983.1.39870 WP_000394983.1.39892 WP_000394983.1.39938 WP_000394983.1.39961 WP_000394983.1.39966 WP_000394983.1.39970 WP_000394983.1.39992 WP_000394983.1.39998 WP_000394983.1.40 WP_000394983.1.40016 WP_000394983.1.40019 WP_000394983.1.4005 WP_000394983.1.40083 WP_000394983.1.40088 WP_000394983.1.40107 WP_000394983.1.40113 WP_000394983.1.40153 WP_000394983.1.40190 WP_000394983.1.40192 WP_000394983.1.4020 WP_000394983.1.40206 WP_000394983.1.40211 WP_000394983.1.40212 WP_000394983.1.40218 WP_000394983.1.40234 WP_000394983.1.40249 WP_000394983.1.40298 WP_000394983.1.4030 WP_000394983.1.40300 WP_000394983.1.40315 WP_000394983.1.40317 WP_000394983.1.40319 WP_000394983.1.40335 WP_000394983.1.40345 WP_000394983.1.40349 WP_000394983.1.40360 WP_000394983.1.40382 WP_000394983.1.40389 WP_000394983.1.40391 WP_000394983.1.40403 WP_000394983.1.40445 WP_000394983.1.40486 WP_000394983.1.4049 WP_000394983.1.40499 WP_000394983.1.40502 WP_000394983.1.40509 WP_000394983.1.40524 WP_000394983.1.40539 WP_000394983.1.40548 WP_000394983.1.40560 WP_000394983.1.40599 WP_000394983.1.406 WP_000394983.1.40607 WP_000394983.1.40617 WP_000394983.1.40636 WP_000394983.1.40657 WP_000394983.1.40660 WP_000394983.1.40666 WP_000394983.1.40686 WP_000394983.1.40712 WP_000394983.1.40715 WP_000394983.1.40742 WP_000394983.1.40758 WP_000394983.1.40781 WP_000394983.1.40793 WP_000394983.1.40813 WP_000394983.1.40815 WP_000394983.1.4082 WP_000394983.1.40833 WP_000394983.1.40842 WP_000394983.1.40843 WP_000394983.1.40865 WP_000394983.1.40882 WP_000394983.1.40893 WP_000394983.1.40898 WP_000394983.1.40912 WP_000394983.1.40937 WP_000394983.1.40952 WP_000394983.1.40965 WP_000394983.1.4103 WP_000394983.1.41037 WP_000394983.1.41041 WP_000394983.1.41045 WP_000394983.1.41060 WP_000394983.1.41063 WP_000394983.1.41078 WP_000394983.1.41113 WP_000394983.1.41125 WP_000394983.1.41147 WP_000394983.1.41206 WP_000394983.1.4122 WP_000394983.1.41239 WP_000394983.1.4126 WP_000394983.1.41263 WP_000394983.1.41287 WP_000394983.1.41294 WP_000394983.1.41315 WP_000394983.1.41330 WP_000394983.1.41346 WP_000394983.1.41363 WP_000394983.1.41368 WP_000394983.1.41371 WP_000394983.1.41392 WP_000394983.1.41394 WP_000394983.1.41401 WP_000394983.1.41402 WP_000394983.1.41407 WP_000394983.1.41417 WP_000394983.1.4142 WP_000394983.1.41436 WP_000394983.1.41453 WP_000394983.1.41455 WP_000394983.1.41478 WP_000394983.1.41481 WP_000394983.1.41482 WP_000394983.1.41488 WP_000394983.1.41530 WP_000394983.1.41536 WP_000394983.1.41545 WP_000394983.1.41556 WP_000394983.1.41566 WP_000394983.1.41613 WP_000394983.1.41621 WP_000394983.1.41651 WP_000394983.1.41654 WP_000394983.1.41712 WP_000394983.1.4172 WP_000394983.1.41734 WP_000394983.1.41740 WP_000394983.1.41752 WP_000394983.1.41780 WP_000394983.1.41782 WP_000394983.1.41783 WP_000394983.1.41809 WP_000394983.1.41813 WP_000394983.1.41826 WP_000394983.1.41847 WP_000394983.1.41884 WP_000394983.1.4189 WP_000394983.1.41900 WP_000394983.1.41923 WP_000394983.1.41960 WP_000394983.1.41988 WP_000394983.1.41990 WP_000394983.1.42022 WP_000394983.1.42027 WP_000394983.1.42033 WP_000394983.1.42036 WP_000394983.1.42038 WP_000394983.1.42044 WP_000394983.1.42060 WP_000394983.1.42073 WP_000394983.1.42113 WP_000394983.1.4213 WP_000394983.1.42138 WP_000394983.1.4214 WP_000394983.1.42159 WP_000394983.1.42203 WP_000394983.1.42209 WP_000394983.1.42214 WP_000394983.1.42221 WP_000394983.1.42226 WP_000394983.1.42228 WP_000394983.1.42233 WP_000394983.1.4224 WP_000394983.1.42252 WP_000394983.1.42258 WP_000394983.1.42318 WP_000394983.1.42350 WP_000394983.1.42367 WP_000394983.1.42376 WP_000394983.1.42387 WP_000394983.1.42413 WP_000394983.1.42415 WP_000394983.1.4242 WP_000394983.1.42432 WP_000394983.1.42442 WP_000394983.1.42443 WP_000394983.1.42447 WP_000394983.1.42480 WP_000394983.1.4250 WP_000394983.1.42513 WP_000394983.1.42522 WP_000394983.1.42547 WP_000394983.1.42586 WP_000394983.1.42594 WP_000394983.1.42597 WP_000394983.1.42600 WP_000394983.1.42601 WP_000394983.1.4261 WP_000394983.1.42638 WP_000394983.1.42661 WP_000394983.1.42669 WP_000394983.1.42670 WP_000394983.1.42677 WP_000394983.1.42709 WP_000394983.1.42728 WP_000394983.1.42748 WP_000394983.1.42749 WP_000394983.1.42770 WP_000394983.1.42771 WP_000394983.1.42804 WP_000394983.1.42808 WP_000394983.1.42813 WP_000394983.1.4282 WP_000394983.1.42832 WP_000394983.1.42879 WP_000394983.1.42891 WP_000394983.1.4290 WP_000394983.1.42918 WP_000394983.1.42962 WP_000394983.1.42975 WP_000394983.1.42987 WP_000394983.1.42989 WP_000394983.1.42991 WP_000394983.1.43013 WP_000394983.1.43027 WP_000394983.1.43035 WP_000394983.1.4306 WP_000394983.1.43121 WP_000394983.1.43123 WP_000394983.1.4313 WP_000394983.1.43132 WP_000394983.1.43137 WP_000394983.1.43140 WP_000394983.1.43166 WP_000394983.1.43170 WP_000394983.1.43174 WP_000394983.1.43177 WP_000394983.1.43196 WP_000394983.1.43213 WP_000394983.1.43216 WP_000394983.1.43239 WP_000394983.1.43270 WP_000394983.1.43278 WP_000394983.1.43316 WP_000394983.1.43363 WP_000394983.1.43384 WP_000394983.1.43389 WP_000394983.1.4342 WP_000394983.1.43422 WP_000394983.1.43427 WP_000394983.1.4343 WP_000394983.1.43444 WP_000394983.1.43448 WP_000394983.1.43455 WP_000394983.1.43469 WP_000394983.1.43473 WP_000394983.1.43489 WP_000394983.1.43536 WP_000394983.1.4356 WP_000394983.1.43598 WP_000394983.1.436 WP_000394983.1.43604 WP_000394983.1.43622 WP_000394983.1.43720 WP_000394983.1.43733 WP_000394983.1.43738 WP_000394983.1.43754 WP_000394983.1.43798 WP_000394983.1.43803 WP_000394983.1.43804 WP_000394983.1.43816 WP_000394983.1.43837 WP_000394983.1.43858 WP_000394983.1.43868 WP_000394983.1.43898 WP_000394983.1.43911 WP_000394983.1.43925 WP_000394983.1.43939 WP_000394983.1.43942 WP_000394983.1.43953 WP_000394983.1.43966 WP_000394983.1.440 WP_000394983.1.44018 WP_000394983.1.44020 WP_000394983.1.44029 WP_000394983.1.44040 WP_000394983.1.44051 WP_000394983.1.44075 WP_000394983.1.44077 WP_000394983.1.44088 WP_000394983.1.44096 WP_000394983.1.4411 WP_000394983.1.44115 WP_000394983.1.44125 WP_000394983.1.4415 WP_000394983.1.44162 WP_000394983.1.44165 WP_000394983.1.44166 WP_000394983.1.44203 WP_000394983.1.44211 WP_000394983.1.44238 WP_000394983.1.44251 WP_000394983.1.44263 WP_000394983.1.44264 WP_000394983.1.44273 WP_000394983.1.44285 WP_000394983.1.44287 WP_000394983.1.44292 WP_000394983.1.44324 WP_000394983.1.44327 WP_000394983.1.44365 WP_000394983.1.44389 WP_000394983.1.44394 WP_000394983.1.44422 WP_000394983.1.44445 WP_000394983.1.44447 WP_000394983.1.44458 WP_000394983.1.44460 WP_000394983.1.44461 WP_000394983.1.4449 WP_000394983.1.44524 WP_000394983.1.4454 WP_000394983.1.44558 WP_000394983.1.44561 WP_000394983.1.44570 WP_000394983.1.44587 WP_000394983.1.4459 WP_000394983.1.44608 WP_000394983.1.44610 WP_000394983.1.44622 WP_000394983.1.4463 WP_000394983.1.44642 WP_000394983.1.44649 WP_000394983.1.44661 WP_000394983.1.44668 WP_000394983.1.4471 WP_000394983.1.44717 WP_000394983.1.44724 WP_000394983.1.44733 WP_000394983.1.44756 WP_000394983.1.44784 WP_000394983.1.44821 WP_000394983.1.44836 WP_000394983.1.44841 WP_000394983.1.44843 WP_000394983.1.44849 WP_000394983.1.44854 WP_000394983.1.44855 WP_000394983.1.44857 WP_000394983.1.44906 WP_000394983.1.44923 WP_000394983.1.44954 WP_000394983.1.44960 WP_000394983.1.44961 WP_000394983.1.44970 WP_000394983.1.44975 WP_000394983.1.44977 WP_000394983.1.44980 WP_000394983.1.45020 WP_000394983.1.45025 WP_000394983.1.45028 WP_000394983.1.45043 WP_000394983.1.45053 WP_000394983.1.45076 WP_000394983.1.45104 WP_000394983.1.45116 WP_000394983.1.45153 WP_000394983.1.4516 WP_000394983.1.45190 WP_000394983.1.45195 WP_000394983.1.45208 WP_000394983.1.4524 WP_000394983.1.45246 WP_000394983.1.45293 WP_000394983.1.4530 WP_000394983.1.45301 WP_000394983.1.45313 WP_000394983.1.45359 WP_000394983.1.4538 WP_000394983.1.45404 WP_000394983.1.45405 WP_000394983.1.4541 WP_000394983.1.45440 WP_000394983.1.45444 WP_000394983.1.4549 WP_000394983.1.45525 WP_000394983.1.45536 WP_000394983.1.45565 WP_000394983.1.45581 WP_000394983.1.45595 WP_000394983.1.45600 WP_000394983.1.45627 WP_000394983.1.4563 WP_000394983.1.45676 WP_000394983.1.4570 WP_000394983.1.45707 WP_000394983.1.45718 WP_000394983.1.4574 WP_000394983.1.45740 WP_000394983.1.45741 WP_000394983.1.45752 WP_000394983.1.4576 WP_000394983.1.45789 WP_000394983.1.45793 WP_000394983.1.45801 WP_000394983.1.4583 WP_000394983.1.45840 WP_000394983.1.45841 WP_000394983.1.45865 WP_000394983.1.45868 WP_000394983.1.45891 WP_000394983.1.45901 WP_000394983.1.45921 WP_000394983.1.4593 WP_000394983.1.45930 WP_000394983.1.45931 WP_000394983.1.45933 WP_000394983.1.45941 WP_000394983.1.45960 WP_000394983.1.45968 WP_000394983.1.45990 WP_000394983.1.46016 WP_000394983.1.46026 WP_000394983.1.46027 WP_000394983.1.46039 WP_000394983.1.46048 WP_000394983.1.46049 WP_000394983.1.46070 WP_000394983.1.46081 WP_000394983.1.46097 WP_000394983.1.4610 WP_000394983.1.46105 WP_000394983.1.46115 WP_000394983.1.46122 WP_000394983.1.4613 WP_000394983.1.46164 WP_000394983.1.46186 WP_000394983.1.46197 WP_000394983.1.46217 WP_000394983.1.46239 WP_000394983.1.46257 WP_000394983.1.46263 WP_000394983.1.46282 WP_000394983.1.46291 WP_000394983.1.46325 WP_000394983.1.46329 WP_000394983.1.46369 WP_000394983.1.46378 WP_000394983.1.46379 WP_000394983.1.46414 WP_000394983.1.46438 WP_000394983.1.46441 WP_000394983.1.46451 WP_000394983.1.4647 WP_000394983.1.46477 WP_000394983.1.46487 WP_000394983.1.46503 WP_000394983.1.46526 WP_000394983.1.46531 WP_000394983.1.46555 WP_000394983.1.4657 WP_000394983.1.46573 WP_000394983.1.46582 WP_000394983.1.46589 WP_000394983.1.46594 WP_000394983.1.46597 WP_000394983.1.46602 WP_000394983.1.46611 WP_000394983.1.46614 WP_000394983.1.46616 WP_000394983.1.46626 WP_000394983.1.46668 WP_000394983.1.4670 WP_000394983.1.46743 WP_000394983.1.46795 WP_000394983.1.46798 WP_000394983.1.46802 WP_000394983.1.46806 WP_000394983.1.46810 WP_000394983.1.46821 WP_000394983.1.46832 WP_000394983.1.46833 WP_000394983.1.46876 WP_000394983.1.46882 WP_000394983.1.46898 WP_000394983.1.46909 WP_000394983.1.4691 WP_000394983.1.46912 WP_000394983.1.46913 WP_000394983.1.46932 WP_000394983.1.4695 WP_000394983.1.46990 WP_000394983.1.46991 WP_000394983.1.46994 WP_000394983.1.46999 WP_000394983.1.47024 WP_000394983.1.47029 WP_000394983.1.47030 WP_000394983.1.47034 WP_000394983.1.47038 WP_000394983.1.47039 WP_000394983.1.47047 WP_000394983.1.47048 WP_000394983.1.47050 WP_000394983.1.47054 WP_000394983.1.47063 WP_000394983.1.47069 WP_000394983.1.47073 WP_000394983.1.4708 WP_000394983.1.47140 WP_000394983.1.47186 WP_000394983.1.47189 WP_000394983.1.47197 WP_000394983.1.47198 WP_000394983.1.4722 WP_000394983.1.47224 WP_000394983.1.47235 WP_000394983.1.47246 WP_000394983.1.47247 WP_000394983.1.4725 WP_000394983.1.47307 WP_000394983.1.47316 WP_000394983.1.47319 WP_000394983.1.47322 WP_000394983.1.47349 WP_000394983.1.47363 WP_000394983.1.47366 WP_000394983.1.47370 WP_000394983.1.47386 WP_000394983.1.47398 WP_000394983.1.47401 WP_000394983.1.47411 WP_000394983.1.47414 WP_000394983.1.47425 WP_000394983.1.4743 WP_000394983.1.47454 WP_000394983.1.47473 WP_000394983.1.47477 WP_000394983.1.47488 WP_000394983.1.47496 WP_000394983.1.47529 WP_000394983.1.47533 WP_000394983.1.47555 WP_000394983.1.47582 WP_000394983.1.47599 WP_000394983.1.47634 WP_000394983.1.47646 WP_000394983.1.47654 WP_000394983.1.47662 WP_000394983.1.47673 WP_000394983.1.47709 WP_000394983.1.4772 WP_000394983.1.47722 WP_000394983.1.47734 WP_000394983.1.47740 WP_000394983.1.47744 WP_000394983.1.47761 WP_000394983.1.47764 WP_000394983.1.47765 WP_000394983.1.47770 WP_000394983.1.47784 WP_000394983.1.47790 WP_000394983.1.47791 WP_000394983.1.47820 WP_000394983.1.47827 WP_000394983.1.4783 WP_000394983.1.47848 WP_000394983.1.4785 WP_000394983.1.47884 WP_000394983.1.47954 WP_000394983.1.4796 WP_000394983.1.47962 WP_000394983.1.47976 WP_000394983.1.47994 WP_000394983.1.48000 WP_000394983.1.48018 WP_000394983.1.48040 WP_000394983.1.48048 WP_000394983.1.48051 WP_000394983.1.48065 WP_000394983.1.48073 WP_000394983.1.48077 WP_000394983.1.48080 WP_000394983.1.48096 WP_000394983.1.4811 WP_000394983.1.48111 WP_000394983.1.4812 WP_000394983.1.48121 WP_000394983.1.48144 WP_000394983.1.48176 WP_000394983.1.48188 WP_000394983.1.48194 WP_000394983.1.48203 WP_000394983.1.48216 WP_000394983.1.48222 WP_000394983.1.48258 WP_000394983.1.4826 WP_000394983.1.48265 WP_000394983.1.48290 WP_000394983.1.48291 WP_000394983.1.48317 WP_000394983.1.48353 WP_000394983.1.48355 WP_000394983.1.48371 WP_000394983.1.48385 WP_000394983.1.48421 WP_000394983.1.48431 WP_000394983.1.48433 WP_000394983.1.48469 WP_000394983.1.48477 WP_000394983.1.48480 WP_000394983.1.48505 WP_000394983.1.48522 WP_000394983.1.4857 WP_000394983.1.486 WP_000394983.1.48615 WP_000394983.1.48620 WP_000394983.1.48629 WP_000394983.1.48678 WP_000394983.1.48689 WP_000394983.1.48697 WP_000394983.1.4871 WP_000394983.1.48712 WP_000394983.1.48792 WP_000394983.1.48801 WP_000394983.1.48806 WP_000394983.1.48808 WP_000394983.1.48827 WP_000394983.1.48847 WP_000394983.1.48901 WP_000394983.1.48902 WP_000394983.1.48910 WP_000394983.1.4892 WP_000394983.1.48921 WP_000394983.1.48926 WP_000394983.1.48928 WP_000394983.1.48953 WP_000394983.1.48954 WP_000394983.1.48970 WP_000394983.1.48974 WP_000394983.1.49001 WP_000394983.1.49061 WP_000394983.1.49107 WP_000394983.1.49124 WP_000394983.1.49136 WP_000394983.1.49147 WP_000394983.1.49170 WP_000394983.1.49179 WP_000394983.1.49190 WP_000394983.1.49229 WP_000394983.1.49243 WP_000394983.1.49258 WP_000394983.1.49275 WP_000394983.1.49312 WP_000394983.1.49332 WP_000394983.1.49336 WP_000394983.1.49338 WP_000394983.1.49342 WP_000394983.1.49347 WP_000394983.1.49363 WP_000394983.1.49412 WP_000394983.1.49446 WP_000394983.1.49464 WP_000394983.1.49481 WP_000394983.1.49482 WP_000394983.1.49483 WP_000394983.1.4949 WP_000394983.1.49496 WP_000394983.1.49521 WP_000394983.1.49522 WP_000394983.1.49537 WP_000394983.1.49546 WP_000394983.1.49558 WP_000394983.1.49567 WP_000394983.1.49594 WP_000394983.1.49599 WP_000394983.1.49615 WP_000394983.1.49625 WP_000394983.1.49645 WP_000394983.1.49655 WP_000394983.1.49661 WP_000394983.1.49662 WP_000394983.1.49675 WP_000394983.1.49684 WP_000394983.1.497 WP_000394983.1.49712 WP_000394983.1.49722 WP_000394983.1.49733 WP_000394983.1.49740 WP_000394983.1.49747 WP_000394983.1.49768 WP_000394983.1.49771 WP_000394983.1.49774 WP_000394983.1.49783 WP_000394983.1.49794 WP_000394983.1.49820 WP_000394983.1.4985 WP_000394983.1.49856 WP_000394983.1.49861 WP_000394983.1.49879 WP_000394983.1.49883 WP_000394983.1.49884 WP_000394983.1.49900 WP_000394983.1.49902 WP_000394983.1.49941 WP_000394983.1.49950 WP_000394983.1.49954 WP_000394983.1.49972 WP_000394983.1.49987 WP_000394983.1.50006 WP_000394983.1.50008 WP_000394983.1.5003 WP_000394983.1.50056 WP_000394983.1.50058 WP_000394983.1.50078 WP_000394983.1.50098 WP_000394983.1.50113 WP_000394983.1.50119 WP_000394983.1.50146 WP_000394983.1.5017 WP_000394983.1.50182 WP_000394983.1.50187 WP_000394983.1.50191 WP_000394983.1.50196 WP_000394983.1.50207 WP_000394983.1.50214 WP_000394983.1.50228 WP_000394983.1.50230 WP_000394983.1.50258 WP_000394983.1.50266 WP_000394983.1.50269 WP_000394983.1.50270 WP_000394983.1.50278 WP_000394983.1.50345 WP_000394983.1.50353 WP_000394983.1.50358 WP_000394983.1.50361 WP_000394983.1.5037 WP_000394983.1.50380 WP_000394983.1.5040 WP_000394983.1.50412 WP_000394983.1.50418 WP_000394983.1.50452 WP_000394983.1.5046 WP_000394983.1.50548 WP_000394983.1.50549 WP_000394983.1.5056 WP_000394983.1.50564 WP_000394983.1.50579 WP_000394983.1.50585 WP_000394983.1.50586 WP_000394983.1.50608 WP_000394983.1.50616 WP_000394983.1.50627 WP_000394983.1.5064 WP_000394983.1.5067 WP_000394983.1.50690 WP_000394983.1.50700 WP_000394983.1.50717 WP_000394983.1.50725 WP_000394983.1.50762 WP_000394983.1.50887 WP_000394983.1.50936 WP_000394983.1.50947 WP_000394983.1.50957 WP_000394983.1.50969 WP_000394983.1.50988 WP_000394983.1.50990 WP_000394983.1.50996 WP_000394983.1.51013 WP_000394983.1.51027 WP_000394983.1.51042 WP_000394983.1.51058 WP_000394983.1.5106 WP_000394983.1.511 WP_000394983.1.51154 WP_000394983.1.51170 WP_000394983.1.51171 WP_000394983.1.51172 WP_000394983.1.51175 WP_000394983.1.51180 WP_000394983.1.51190 WP_000394983.1.51201 WP_000394983.1.51211 WP_000394983.1.5124 WP_000394983.1.51248 WP_000394983.1.51253 WP_000394983.1.51255 WP_000394983.1.51260 WP_000394983.1.51278 WP_000394983.1.5128 WP_000394983.1.51299 WP_000394983.1.51300 WP_000394983.1.51325 WP_000394983.1.51336 WP_000394983.1.51360 WP_000394983.1.51380 WP_000394983.1.51392 WP_000394983.1.51405 WP_000394983.1.51425 WP_000394983.1.51426 WP_000394983.1.51427 WP_000394983.1.51430 WP_000394983.1.51441 WP_000394983.1.5146 WP_000394983.1.51490 WP_000394983.1.51495 WP_000394983.1.51505 WP_000394983.1.51525 WP_000394983.1.5153 WP_000394983.1.51537 WP_000394983.1.51539 WP_000394983.1.51548 WP_000394983.1.51552 WP_000394983.1.5157 WP_000394983.1.5158 WP_000394983.1.51580 WP_000394983.1.51587 WP_000394983.1.51596 WP_000394983.1.51607 WP_000394983.1.51629 WP_000394983.1.51643 WP_000394983.1.51690 WP_000394983.1.51693 WP_000394983.1.51707 WP_000394983.1.51718 WP_000394983.1.5172 WP_000394983.1.51757 WP_000394983.1.51760 WP_000394983.1.51784 WP_000394983.1.518 WP_000394983.1.51804 WP_000394983.1.51834 WP_000394983.1.51837 WP_000394983.1.51873 WP_000394983.1.51881 WP_000394983.1.51896 WP_000394983.1.51899 WP_000394983.1.51944 WP_000394983.1.51949 WP_000394983.1.51979 WP_000394983.1.51985 WP_000394983.1.5199 WP_000394983.1.51999 WP_000394983.1.52002 WP_000394983.1.52020 WP_000394983.1.52039 WP_000394983.1.52048 WP_000394983.1.52076 WP_000394983.1.52085 WP_000394983.1.52098 WP_000394983.1.52126 WP_000394983.1.52127 WP_000394983.1.52135 WP_000394983.1.52137 WP_000394983.1.5217 WP_000394983.1.52171 WP_000394983.1.52186 WP_000394983.1.52211 WP_000394983.1.52213 WP_000394983.1.52214 WP_000394983.1.52230 WP_000394983.1.52243 WP_000394983.1.52249 WP_000394983.1.52257 WP_000394983.1.52258 WP_000394983.1.5227 WP_000394983.1.52271 WP_000394983.1.52272 WP_000394983.1.52299 WP_000394983.1.52305 WP_000394983.1.52333 WP_000394983.1.52363 WP_000394983.1.5239 WP_000394983.1.52421 WP_000394983.1.52492 WP_000394983.1.52496 WP_000394983.1.52524 WP_000394983.1.52542 WP_000394983.1.52543 WP_000394983.1.52544 WP_000394983.1.52558 WP_000394983.1.52601 WP_000394983.1.52612 WP_000394983.1.52631 WP_000394983.1.5265 WP_000394983.1.52662 WP_000394983.1.52691 WP_000394983.1.52735 WP_000394983.1.52762 WP_000394983.1.52771 WP_000394983.1.52774 WP_000394983.1.52777 WP_000394983.1.52780 WP_000394983.1.52781 WP_000394983.1.5285 WP_000394983.1.52852 WP_000394983.1.52853 WP_000394983.1.52881 WP_000394983.1.52883 WP_000394983.1.52895 WP_000394983.1.52933 WP_000394983.1.52945 WP_000394983.1.52962 WP_000394983.1.52995 WP_000394983.1.53012 WP_000394983.1.53020 WP_000394983.1.53021 WP_000394983.1.53027 WP_000394983.1.53065 WP_000394983.1.53084 WP_000394983.1.5310 WP_000394983.1.53110 WP_000394983.1.53123 WP_000394983.1.53155 WP_000394983.1.53162 WP_000394983.1.532 WP_000394983.1.53211 WP_000394983.1.53223 WP_000394983.1.53238 WP_000394983.1.53244 WP_000394983.1.53251 WP_000394983.1.53262 WP_000394983.1.53270 WP_000394983.1.53327 WP_000394983.1.53360 WP_000394983.1.53364 WP_000394983.1.53377 WP_000394983.1.53401 WP_000394983.1.53410 WP_000394983.1.53415 WP_000394983.1.5342 WP_000394983.1.53482 WP_000394983.1.53505 WP_000394983.1.53537 WP_000394983.1.53557 WP_000394983.1.53587 WP_000394983.1.53589 WP_000394983.1.53592 WP_000394983.1.53594 WP_000394983.1.5362 WP_000394983.1.53645 WP_000394983.1.53649 WP_000394983.1.53687 WP_000394983.1.53690 WP_000394983.1.53693 WP_000394983.1.53706 WP_000394983.1.53769 WP_000394983.1.53809 WP_000394983.1.53810 WP_000394983.1.53811 WP_000394983.1.53863 WP_000394983.1.53866 WP_000394983.1.53878 WP_000394983.1.53884 WP_000394983.1.5391 WP_000394983.1.5393 WP_000394983.1.53931 WP_000394983.1.53940 WP_000394983.1.53972 WP_000394983.1.53978 WP_000394983.1.53994 WP_000394983.1.54002 WP_000394983.1.54013 WP_000394983.1.54023 WP_000394983.1.54024 WP_000394983.1.54028 WP_000394983.1.54051 WP_000394983.1.54091 WP_000394983.1.54095 WP_000394983.1.54102 WP_000394983.1.54144 WP_000394983.1.54169 WP_000394983.1.54188 WP_000394983.1.54202 WP_000394983.1.54208 WP_000394983.1.54213 WP_000394983.1.54263 WP_000394983.1.54307 WP_000394983.1.54313 WP_000394983.1.54317 WP_000394983.1.54329 WP_000394983.1.5433 WP_000394983.1.5434 WP_000394983.1.54344 WP_000394983.1.54359 WP_000394983.1.54388 WP_000394983.1.54394 WP_000394983.1.5441 WP_000394983.1.54411 WP_000394983.1.54418 WP_000394983.1.54439 WP_000394983.1.54454 WP_000394983.1.54476 WP_000394983.1.54507 WP_000394983.1.54524 WP_000394983.1.54534 WP_000394983.1.54546 WP_000394983.1.54590 WP_000394983.1.54591 WP_000394983.1.54601 WP_000394983.1.54602 WP_000394983.1.54605 WP_000394983.1.5461 WP_000394983.1.54617 WP_000394983.1.54620 WP_000394983.1.54625 WP_000394983.1.54638 WP_000394983.1.5467 WP_000394983.1.54688 WP_000394983.1.54695 WP_000394983.1.5470 WP_000394983.1.54708 WP_000394983.1.54725 WP_000394983.1.54729 WP_000394983.1.54754 WP_000394983.1.54760 WP_000394983.1.54769 WP_000394983.1.5478 WP_000394983.1.5479 WP_000394983.1.54798 WP_000394983.1.54817 WP_000394983.1.54829 WP_000394983.1.5486 WP_000394983.1.54875 WP_000394983.1.54883 WP_000394983.1.54918 WP_000394983.1.54927 WP_000394983.1.54940 WP_000394983.1.54941 WP_000394983.1.54981 WP_000394983.1.54991 WP_000394983.1.54993 WP_000394983.1.55003 WP_000394983.1.55005 WP_000394983.1.55009 WP_000394983.1.55041 WP_000394983.1.55115 WP_000394983.1.55123 WP_000394983.1.55134 WP_000394983.1.55144 WP_000394983.1.55149 WP_000394983.1.55151 WP_000394983.1.55177 WP_000394983.1.55179 WP_000394983.1.55197 WP_000394983.1.5520 WP_000394983.1.55203 WP_000394983.1.55218 WP_000394983.1.55222 WP_000394983.1.55273 WP_000394983.1.55286 WP_000394983.1.55338 WP_000394983.1.55357 WP_000394983.1.55359 WP_000394983.1.55374 WP_000394983.1.55381 WP_000394983.1.55417 WP_000394983.1.55420 WP_000394983.1.55424 WP_000394983.1.55425 WP_000394983.1.5546 WP_000394983.1.55466 WP_000394983.1.55472 WP_000394983.1.55489 WP_000394983.1.55492 WP_000394983.1.55507 WP_000394983.1.55529 WP_000394983.1.55550 WP_000394983.1.55551 WP_000394983.1.55552 WP_000394983.1.55556 WP_000394983.1.55560 WP_000394983.1.55563 WP_000394983.1.55571 WP_000394983.1.55574 WP_000394983.1.55608 WP_000394983.1.5561 WP_000394983.1.55629 WP_000394983.1.55676 WP_000394983.1.5570 WP_000394983.1.55709 WP_000394983.1.55720 WP_000394983.1.55731 WP_000394983.1.55744 WP_000394983.1.55757 WP_000394983.1.55787 WP_000394983.1.55790 WP_000394983.1.55791 WP_000394983.1.55808 WP_000394983.1.55825 WP_000394983.1.55838 WP_000394983.1.55844 WP_000394983.1.55868 WP_000394983.1.55888 WP_000394983.1.55892 WP_000394983.1.55896 WP_000394983.1.55897 WP_000394983.1.55936 WP_000394983.1.55981 WP_000394983.1.55988 WP_000394983.1.56033 WP_000394983.1.56040 WP_000394983.1.56072 WP_000394983.1.56122 WP_000394983.1.56139 WP_000394983.1.5614 WP_000394983.1.56142 WP_000394983.1.56149 WP_000394983.1.56151 WP_000394983.1.5616 WP_000394983.1.56164 WP_000394983.1.56177 WP_000394983.1.56193 WP_000394983.1.56197 WP_000394983.1.562 WP_000394983.1.56216 WP_000394983.1.56231 WP_000394983.1.56278 WP_000394983.1.56285 WP_000394983.1.56293 WP_000394983.1.56302 WP_000394983.1.5632 WP_000394983.1.56338 WP_000394983.1.56371 WP_000394983.1.5639 WP_000394983.1.56390 WP_000394983.1.56392 WP_000394983.1.56399 WP_000394983.1.56402 WP_000394983.1.56439 WP_000394983.1.56446 WP_000394983.1.56457 WP_000394983.1.5646 WP_000394983.1.56469 WP_000394983.1.56481 WP_000394983.1.56489 WP_000394983.1.56491 WP_000394983.1.56501 WP_000394983.1.56502 WP_000394983.1.56513 WP_000394983.1.56523 WP_000394983.1.56528 WP_000394983.1.56543 WP_000394983.1.56554 WP_000394983.1.56571 WP_000394983.1.56573 WP_000394983.1.56650 WP_000394983.1.56662 WP_000394983.1.56665 WP_000394983.1.56680 WP_000394983.1.56689 WP_000394983.1.5670 WP_000394983.1.56704 WP_000394983.1.56714 WP_000394983.1.56721 WP_000394983.1.56742 WP_000394983.1.56776 WP_000394983.1.56786 WP_000394983.1.56787 WP_000394983.1.56789 WP_000394983.1.56821 WP_000394983.1.56830 WP_000394983.1.56835 WP_000394983.1.56846 WP_000394983.1.5685 WP_000394983.1.56871 WP_000394983.1.56882 WP_000394983.1.56932 WP_000394983.1.56933 WP_000394983.1.56934 WP_000394983.1.56936 WP_000394983.1.56937 WP_000394983.1.56941 WP_000394983.1.56978 WP_000394983.1.56980 WP_000394983.1.57032 WP_000394983.1.57045 WP_000394983.1.57051 WP_000394983.1.57071 WP_000394983.1.57072 WP_000394983.1.57079 WP_000394983.1.57086 WP_000394983.1.57100 WP_000394983.1.57124 WP_000394983.1.57159 WP_000394983.1.57180 WP_000394983.1.57181 WP_000394983.1.57182 WP_000394983.1.57185 WP_000394983.1.57197 WP_000394983.1.57202 WP_000394983.1.57213 WP_000394983.1.57216 WP_000394983.1.57222 WP_000394983.1.57254 WP_000394983.1.57266 WP_000394983.1.57278 WP_000394983.1.57280 WP_000394983.1.57401 WP_000394983.1.57403 WP_000394983.1.57410 WP_000394983.1.57414 WP_000394983.1.5742 WP_000394983.1.57432 WP_000394983.1.57451 WP_000394983.1.57466 WP_000394983.1.5748 WP_000394983.1.57487 WP_000394983.1.57517 WP_000394983.1.57538 WP_000394983.1.57539 WP_000394983.1.5755 WP_000394983.1.57608 WP_000394983.1.57610 WP_000394983.1.57629 WP_000394983.1.5764 WP_000394983.1.57646 WP_000394983.1.57659 WP_000394983.1.57663 WP_000394983.1.57719 WP_000394983.1.57738 WP_000394983.1.57812 WP_000394983.1.57832 WP_000394983.1.57836 WP_000394983.1.57846 WP_000394983.1.57854 WP_000394983.1.5786 WP_000394983.1.5787 WP_000394983.1.57898 WP_000394983.1.57904 WP_000394983.1.57920 WP_000394983.1.57983 WP_000394983.1.57994 WP_000394983.1.58001 WP_000394983.1.58009 WP_000394983.1.58022 WP_000394983.1.58045 WP_000394983.1.58057 WP_000394983.1.58060 WP_000394983.1.58080 WP_000394983.1.58094 WP_000394983.1.58097 WP_000394983.1.58098 WP_000394983.1.58107 WP_000394983.1.58143 WP_000394983.1.58146 WP_000394983.1.58163 WP_000394983.1.58169 WP_000394983.1.58226 WP_000394983.1.58232 WP_000394983.1.58233 WP_000394983.1.58238 WP_000394983.1.58248 WP_000394983.1.58267 WP_000394983.1.58289 WP_000394983.1.58292 WP_000394983.1.58316 WP_000394983.1.58340 WP_000394983.1.58345 WP_000394983.1.58371 WP_000394983.1.58384 WP_000394983.1.584 WP_000394983.1.58401 WP_000394983.1.58414 WP_000394983.1.5842 WP_000394983.1.58420 WP_000394983.1.58423 WP_000394983.1.58424 WP_000394983.1.58429 WP_000394983.1.58440 WP_000394983.1.58445 WP_000394983.1.58449 WP_000394983.1.58459 WP_000394983.1.58475 WP_000394983.1.58493 WP_000394983.1.585 WP_000394983.1.58507 WP_000394983.1.58514 WP_000394983.1.5852 WP_000394983.1.58528 WP_000394983.1.58547 WP_000394983.1.58552 WP_000394983.1.58560 WP_000394983.1.58572 WP_000394983.1.58582 WP_000394983.1.58609 WP_000394983.1.58617 WP_000394983.1.58622 WP_000394983.1.58657 WP_000394983.1.58705 WP_000394983.1.58707 WP_000394983.1.58723 WP_000394983.1.58737 WP_000394983.1.58799 WP_000394983.1.58867 WP_000394983.1.58870 WP_000394983.1.58940 WP_000394983.1.58942 WP_000394983.1.58951 WP_000394983.1.58958 WP_000394983.1.58976 WP_000394983.1.58983 WP_000394983.1.58999 WP_000394983.1.59024 WP_000394983.1.59026 WP_000394983.1.59035 WP_000394983.1.59038 WP_000394983.1.59055 WP_000394983.1.5906 WP_000394983.1.59060 WP_000394983.1.59073 WP_000394983.1.59119 WP_000394983.1.59174 WP_000394983.1.59190 WP_000394983.1.59199 WP_000394983.1.5927 WP_000394983.1.59293 WP_000394983.1.59306 WP_000394983.1.59359 WP_000394983.1.59374 WP_000394983.1.59395 WP_000394983.1.59407 WP_000394983.1.59409 WP_000394983.1.59413 WP_000394983.1.5942 WP_000394983.1.59423 WP_000394983.1.59425 WP_000394983.1.59426 WP_000394983.1.59434 WP_000394983.1.59470 WP_000394983.1.59483 WP_000394983.1.59491 WP_000394983.1.59513 WP_000394983.1.59533 WP_000394983.1.59553 WP_000394983.1.59572 WP_000394983.1.59579 WP_000394983.1.59590 WP_000394983.1.59611 WP_000394983.1.59613 WP_000394983.1.59615 WP_000394983.1.59621 WP_000394983.1.59638 WP_000394983.1.5965 WP_000394983.1.59660 WP_000394983.1.59679 WP_000394983.1.59699 WP_000394983.1.59714 WP_000394983.1.59733 WP_000394983.1.59737 WP_000394983.1.59745 WP_000394983.1.59748 WP_000394983.1.59756 WP_000394983.1.59782 WP_000394983.1.59788 WP_000394983.1.59791 WP_000394983.1.59793 WP_000394983.1.59815 WP_000394983.1.59823 WP_000394983.1.59838 WP_000394983.1.59858 WP_000394983.1.59877 WP_000394983.1.59894 WP_000394983.1.59900 WP_000394983.1.59905 WP_000394983.1.59912 WP_000394983.1.59931 WP_000394983.1.59932 WP_000394983.1.59959 WP_000394983.1.59970 WP_000394983.1.59980 WP_000394983.1.59981 WP_000394983.1.59998 WP_000394983.1.6002 WP_000394983.1.60023 WP_000394983.1.60042 WP_000394983.1.60043 WP_000394983.1.60067 WP_000394983.1.60070 WP_000394983.1.60095 WP_000394983.1.60096 WP_000394983.1.6013 WP_000394983.1.60133 WP_000394983.1.60151 WP_000394983.1.6022 WP_000394983.1.60225 WP_000394983.1.60228 WP_000394983.1.60235 WP_000394983.1.60304 WP_000394983.1.60325 WP_000394983.1.60337 WP_000394983.1.60343 WP_000394983.1.60350 WP_000394983.1.60373 WP_000394983.1.60374 WP_000394983.1.60387 WP_000394983.1.60436 WP_000394983.1.60457 WP_000394983.1.60461 WP_000394983.1.60477 WP_000394983.1.60498 WP_000394983.1.60505 WP_000394983.1.60544 WP_000394983.1.60550 WP_000394983.1.60555 WP_000394983.1.60576 WP_000394983.1.6059 WP_000394983.1.60591 WP_000394983.1.60606 WP_000394983.1.60613 WP_000394983.1.60630 WP_000394983.1.6064 WP_000394983.1.60647 WP_000394983.1.60654 WP_000394983.1.6066 WP_000394983.1.6068 WP_000394983.1.60698 WP_000394983.1.60717 WP_000394983.1.60744 WP_000394983.1.60761 WP_000394983.1.60805 WP_000394983.1.60832 WP_000394983.1.60835 WP_000394983.1.60872 WP_000394983.1.60895 WP_000394983.1.60901 WP_000394983.1.60925 WP_000394983.1.60927 WP_000394983.1.60935 WP_000394983.1.6094 WP_000394983.1.60974 WP_000394983.1.61005 WP_000394983.1.61006 WP_000394983.1.61046 WP_000394983.1.61058 WP_000394983.1.6106 WP_000394983.1.61096 WP_000394983.1.61097 WP_000394983.1.61099 WP_000394983.1.6110 WP_000394983.1.61102 WP_000394983.1.61112 WP_000394983.1.61132 WP_000394983.1.61170 WP_000394983.1.61174 WP_000394983.1.61181 WP_000394983.1.61183 WP_000394983.1.61225 WP_000394983.1.61241 WP_000394983.1.61245 WP_000394983.1.61253 WP_000394983.1.613 WP_000394983.1.61364 WP_000394983.1.6138 WP_000394983.1.61442 WP_000394983.1.61445 WP_000394983.1.61480 WP_000394983.1.615 WP_000394983.1.61505 WP_000394983.1.61517 WP_000394983.1.61524 WP_000394983.1.61608 WP_000394983.1.61617 WP_000394983.1.61623 WP_000394983.1.61636 WP_000394983.1.61663 WP_000394983.1.61739 WP_000394983.1.61758 WP_000394983.1.61779 WP_000394983.1.61789 WP_000394983.1.61806 WP_000394983.1.61822 WP_000394983.1.61835 WP_000394983.1.61853 WP_000394983.1.61858 WP_000394983.1.61874 WP_000394983.1.61926 WP_000394983.1.61939 WP_000394983.1.61948 WP_000394983.1.61949 WP_000394983.1.61957 WP_000394983.1.61985 WP_000394983.1.62038 WP_000394983.1.62041 WP_000394983.1.62091 WP_000394983.1.62099 WP_000394983.1.62102 WP_000394983.1.6212 WP_000394983.1.62135 WP_000394983.1.62157 WP_000394983.1.62182 WP_000394983.1.62207 WP_000394983.1.62236 WP_000394983.1.62273 WP_000394983.1.62282 WP_000394983.1.62290 WP_000394983.1.62322 WP_000394983.1.62337 WP_000394983.1.62358 WP_000394983.1.62447 WP_000394983.1.62454 WP_000394983.1.62480 WP_000394983.1.62503 WP_000394983.1.62514 WP_000394983.1.62529 WP_000394983.1.62541 WP_000394983.1.62555 WP_000394983.1.62586 WP_000394983.1.6261 WP_000394983.1.62612 WP_000394983.1.62631 WP_000394983.1.62642 WP_000394983.1.62668 WP_000394983.1.62675 WP_000394983.1.62681 WP_000394983.1.62714 WP_000394983.1.62735 WP_000394983.1.62750 WP_000394983.1.62762 WP_000394983.1.62769 WP_000394983.1.62780 WP_000394983.1.62784 WP_000394983.1.62787 WP_000394983.1.62788 WP_000394983.1.62812 WP_000394983.1.62818 WP_000394983.1.62819 WP_000394983.1.6282 WP_000394983.1.62840 WP_000394983.1.62843 WP_000394983.1.62850 WP_000394983.1.62851 WP_000394983.1.62866 WP_000394983.1.62885 WP_000394983.1.62888 WP_000394983.1.62931 WP_000394983.1.62951 WP_000394983.1.62959 WP_000394983.1.62973 WP_000394983.1.62989 WP_000394983.1.6299 WP_000394983.1.63078 WP_000394983.1.63167 WP_000394983.1.63177 WP_000394983.1.63189 WP_000394983.1.63246 WP_000394983.1.63271 WP_000394983.1.63285 WP_000394983.1.63287 WP_000394983.1.63305 WP_000394983.1.6331 WP_000394983.1.63310 WP_000394983.1.6334 WP_000394983.1.6337 WP_000394983.1.63370 WP_000394983.1.63393 WP_000394983.1.63419 WP_000394983.1.63433 WP_000394983.1.63437 WP_000394983.1.63445 WP_000394983.1.63453 WP_000394983.1.63465 WP_000394983.1.63466 WP_000394983.1.63467 WP_000394983.1.63470 WP_000394983.1.63478 WP_000394983.1.6348 WP_000394983.1.63484 WP_000394983.1.63487 WP_000394983.1.63491 WP_000394983.1.63496 WP_000394983.1.63556 WP_000394983.1.63563 WP_000394983.1.63576 WP_000394983.1.63586 WP_000394983.1.63608 WP_000394983.1.63615 WP_000394983.1.6364 WP_000394983.1.63666 WP_000394983.1.63683 WP_000394983.1.63703 WP_000394983.1.63721 WP_000394983.1.63810 WP_000394983.1.63814 WP_000394983.1.63821 WP_000394983.1.63944 WP_000394983.1.63957 WP_000394983.1.63964 WP_000394983.1.63969 WP_000394983.1.63990 WP_000394983.1.64008 WP_000394983.1.64014 WP_000394983.1.64030 WP_000394983.1.64040 WP_000394983.1.64050 WP_000394983.1.64053 WP_000394983.1.64074 WP_000394983.1.64080 WP_000394983.1.64086 WP_000394983.1.64110 WP_000394983.1.64150 WP_000394983.1.6416 WP_000394983.1.64161 WP_000394983.1.64175 WP_000394983.1.64180 WP_000394983.1.64190 WP_000394983.1.64193 WP_000394983.1.64285 WP_000394983.1.64286 WP_000394983.1.643 WP_000394983.1.6431 WP_000394983.1.64312 WP_000394983.1.64321 WP_000394983.1.64330 WP_000394983.1.64337 WP_000394983.1.64353 WP_000394983.1.64355 WP_000394983.1.64356 WP_000394983.1.64371 WP_000394983.1.64380 WP_000394983.1.64391 WP_000394983.1.6441 WP_000394983.1.64417 WP_000394983.1.64438 WP_000394983.1.6444 WP_000394983.1.64448 WP_000394983.1.6445 WP_000394983.1.64458 WP_000394983.1.6446 WP_000394983.1.64519 WP_000394983.1.64520 WP_000394983.1.64528 WP_000394983.1.64547 WP_000394983.1.64563 WP_000394983.1.64621 WP_000394983.1.64657 WP_000394983.1.64670 WP_000394983.1.64693 WP_000394983.1.64695 WP_000394983.1.647 WP_000394983.1.64707 WP_000394983.1.64712 WP_000394983.1.64746 WP_000394983.1.64749 WP_000394983.1.64784 WP_000394983.1.64789 WP_000394983.1.64840 WP_000394983.1.64875 WP_000394983.1.64881 WP_000394983.1.64901 WP_000394983.1.64912 WP_000394983.1.64926 WP_000394983.1.64939 WP_000394983.1.64946 WP_000394983.1.64970 WP_000394983.1.6499 WP_000394983.1.64990 WP_000394983.1.6500 WP_000394983.1.65023 WP_000394983.1.65035 WP_000394983.1.65040 WP_000394983.1.65097 WP_000394983.1.651 WP_000394983.1.65104 WP_000394983.1.6511 WP_000394983.1.65110 WP_000394983.1.65114 WP_000394983.1.65116 WP_000394983.1.65118 WP_000394983.1.65122 WP_000394983.1.65151 WP_000394983.1.65179 WP_000394983.1.65194 WP_000394983.1.65206 WP_000394983.1.65240 WP_000394983.1.65256 WP_000394983.1.6527 WP_000394983.1.65271 WP_000394983.1.65286 WP_000394983.1.65305 WP_000394983.1.65306 WP_000394983.1.65353 WP_000394983.1.65355 WP_000394983.1.65364 WP_000394983.1.65366 WP_000394983.1.6537 WP_000394983.1.65370 WP_000394983.1.654 WP_000394983.1.65405 WP_000394983.1.65415 WP_000394983.1.65456 WP_000394983.1.65493 WP_000394983.1.65531 WP_000394983.1.65571 WP_000394983.1.65596 WP_000394983.1.65606 WP_000394983.1.6563 WP_000394983.1.65672 WP_000394983.1.65708 WP_000394983.1.65749 WP_000394983.1.6576 WP_000394983.1.65762 WP_000394983.1.6587 WP_000394983.1.65875 WP_000394983.1.65912 WP_000394983.1.65954 WP_000394983.1.65957 WP_000394983.1.65961 WP_000394983.1.65962 WP_000394983.1.65963 WP_000394983.1.65976 WP_000394983.1.6599 WP_000394983.1.65991 WP_000394983.1.66001 WP_000394983.1.66007 WP_000394983.1.66017 WP_000394983.1.6604 WP_000394983.1.66044 WP_000394983.1.66050 WP_000394983.1.66071 WP_000394983.1.6609 WP_000394983.1.66094 WP_000394983.1.66100 WP_000394983.1.66104 WP_000394983.1.66105 WP_000394983.1.66121 WP_000394983.1.66127 WP_000394983.1.6618 WP_000394983.1.66181 WP_000394983.1.66251 WP_000394983.1.66255 WP_000394983.1.66280 WP_000394983.1.66288 WP_000394983.1.66290 WP_000394983.1.66295 WP_000394983.1.6635 WP_000394983.1.66376 WP_000394983.1.66387 WP_000394983.1.66389 WP_000394983.1.66392 WP_000394983.1.66395 WP_000394983.1.66412 WP_000394983.1.66421 WP_000394983.1.66448 WP_000394983.1.6645 WP_000394983.1.66501 WP_000394983.1.66523 WP_000394983.1.66531 WP_000394983.1.6654 WP_000394983.1.66559 WP_000394983.1.66566 WP_000394983.1.66579 WP_000394983.1.66624 WP_000394983.1.66644 WP_000394983.1.6665 WP_000394983.1.6666 WP_000394983.1.66667 WP_000394983.1.66668 WP_000394983.1.66700 WP_000394983.1.66706 WP_000394983.1.66708 WP_000394983.1.66719 WP_000394983.1.66751 WP_000394983.1.66758 WP_000394983.1.6676 WP_000394983.1.66783 WP_000394983.1.66787 WP_000394983.1.66794 WP_000394983.1.66795 WP_000394983.1.66796 WP_000394983.1.66926 WP_000394983.1.66933 WP_000394983.1.6698 WP_000394983.1.66984 WP_000394983.1.67018 WP_000394983.1.67021 WP_000394983.1.67022 WP_000394983.1.67026 WP_000394983.1.67029 WP_000394983.1.67035 WP_000394983.1.67055 WP_000394983.1.67073 WP_000394983.1.67102 WP_000394983.1.67132 WP_000394983.1.67136 WP_000394983.1.67137 WP_000394983.1.67149 WP_000394983.1.67150 WP_000394983.1.67153 WP_000394983.1.67164 WP_000394983.1.67174 WP_000394983.1.67194 WP_000394983.1.67200 WP_000394983.1.67209 WP_000394983.1.67210 WP_000394983.1.67214 WP_000394983.1.6723 WP_000394983.1.67258 WP_000394983.1.67278 WP_000394983.1.67284 WP_000394983.1.67293 WP_000394983.1.6735 WP_000394983.1.67383 WP_000394983.1.67415 WP_000394983.1.67427 WP_000394983.1.67446 WP_000394983.1.67451 WP_000394983.1.67452 WP_000394983.1.67464 WP_000394983.1.67468 WP_000394983.1.67495 WP_000394983.1.67522 WP_000394983.1.67533 WP_000394983.1.67538 WP_000394983.1.67549 WP_000394983.1.67553 WP_000394983.1.67581 WP_000394983.1.67590 WP_000394983.1.67606 WP_000394983.1.67660 WP_000394983.1.67663 WP_000394983.1.67669 WP_000394983.1.67676 WP_000394983.1.67690 WP_000394983.1.67701 WP_000394983.1.67724 WP_000394983.1.67726 WP_000394983.1.67737 WP_000394983.1.67753 WP_000394983.1.67758 WP_000394983.1.67760 WP_000394983.1.67775 WP_000394983.1.67780 WP_000394983.1.67786 WP_000394983.1.67787 WP_000394983.1.67788 WP_000394983.1.678 WP_000394983.1.67810 WP_000394983.1.67841 WP_000394983.1.67853 WP_000394983.1.67861 WP_000394983.1.67891 WP_000394983.1.67894 WP_000394983.1.67975 WP_000394983.1.67990 WP_000394983.1.67992 WP_000394983.1.67999 WP_000394983.1.68008 WP_000394983.1.68011 WP_000394983.1.68012 WP_000394983.1.6803 WP_000394983.1.68039 WP_000394983.1.68052 WP_000394983.1.68058 WP_000394983.1.68059 WP_000394983.1.68063 WP_000394983.1.68069 WP_000394983.1.68071 WP_000394983.1.68096 WP_000394983.1.6810 WP_000394983.1.6814 WP_000394983.1.68157 WP_000394983.1.68170 WP_000394983.1.68175 WP_000394983.1.68177 WP_000394983.1.682 WP_000394983.1.68200 WP_000394983.1.68215 WP_000394983.1.68231 WP_000394983.1.68241 WP_000394983.1.68255 WP_000394983.1.68278 WP_000394983.1.68279 WP_000394983.1.68283 WP_000394983.1.68292 WP_000394983.1.68300 WP_000394983.1.68336 WP_000394983.1.68341 WP_000394983.1.68347 WP_000394983.1.68362 WP_000394983.1.68372 WP_000394983.1.68395 WP_000394983.1.68411 WP_000394983.1.68441 WP_000394983.1.68442 WP_000394983.1.68490 WP_000394983.1.68493 WP_000394983.1.68523 WP_000394983.1.68524 WP_000394983.1.68534 WP_000394983.1.68566 WP_000394983.1.68572 WP_000394983.1.6859 WP_000394983.1.6860 WP_000394983.1.68609 WP_000394983.1.68673 WP_000394983.1.68678 WP_000394983.1.68695 WP_000394983.1.68701 WP_000394983.1.68711 WP_000394983.1.68735 WP_000394983.1.68750 WP_000394983.1.68751 WP_000394983.1.6877 WP_000394983.1.68793 WP_000394983.1.68795 WP_000394983.1.68797 WP_000394983.1.6880 WP_000394983.1.68801 WP_000394983.1.68838 WP_000394983.1.68847 WP_000394983.1.68865 WP_000394983.1.6887 WP_000394983.1.68873 WP_000394983.1.68877 WP_000394983.1.68911 WP_000394983.1.68915 WP_000394983.1.68924 WP_000394983.1.68936 WP_000394983.1.68942 WP_000394983.1.68952 WP_000394983.1.68956 WP_000394983.1.68989 WP_000394983.1.68995 WP_000394983.1.69054 WP_000394983.1.69098 WP_000394983.1.69126 WP_000394983.1.69144 WP_000394983.1.6916 WP_000394983.1.69221 WP_000394983.1.6923 WP_000394983.1.69247 WP_000394983.1.69258 WP_000394983.1.69261 WP_000394983.1.69303 WP_000394983.1.69305 WP_000394983.1.69327 WP_000394983.1.69341 WP_000394983.1.69350 WP_000394983.1.69351 WP_000394983.1.69382 WP_000394983.1.69390 WP_000394983.1.694 WP_000394983.1.69438 WP_000394983.1.6945 WP_000394983.1.69450 WP_000394983.1.69472 WP_000394983.1.69473 WP_000394983.1.69502 WP_000394983.1.69506 WP_000394983.1.69551 WP_000394983.1.69583 WP_000394983.1.69589 WP_000394983.1.69596 WP_000394983.1.69643 WP_000394983.1.69646 WP_000394983.1.69649 WP_000394983.1.69655 WP_000394983.1.69689 WP_000394983.1.697 WP_000394983.1.69716 WP_000394983.1.69735 WP_000394983.1.69780 WP_000394983.1.69803 WP_000394983.1.69810 WP_000394983.1.69818 WP_000394983.1.69831 WP_000394983.1.69832 WP_000394983.1.69887 WP_000394983.1.69896 WP_000394983.1.6993 WP_000394983.1.69963 WP_000394983.1.69999 WP_000394983.1.70041 WP_000394983.1.701 WP_000394983.1.70123 WP_000394983.1.70149 WP_000394983.1.7015 WP_000394983.1.70190 WP_000394983.1.70200 WP_000394983.1.70213 WP_000394983.1.70230 WP_000394983.1.70300 WP_000394983.1.70337 WP_000394983.1.70357 WP_000394983.1.70386 WP_000394983.1.70407 WP_000394983.1.70408 WP_000394983.1.70414 WP_000394983.1.70477 WP_000394983.1.70492 WP_000394983.1.7050 WP_000394983.1.70517 WP_000394983.1.7052 WP_000394983.1.70539 WP_000394983.1.70563 WP_000394983.1.70576 WP_000394983.1.70578 WP_000394983.1.70582 WP_000394983.1.70592 WP_000394983.1.70597 WP_000394983.1.70619 WP_000394983.1.70628 WP_000394983.1.70655 WP_000394983.1.70686 WP_000394983.1.70694 WP_000394983.1.70698 WP_000394983.1.70705 WP_000394983.1.70713 WP_000394983.1.70723 WP_000394983.1.70745 WP_000394983.1.70787 WP_000394983.1.70794 WP_000394983.1.70801 WP_000394983.1.70803 WP_000394983.1.70880 WP_000394983.1.70896 WP_000394983.1.70900 WP_000394983.1.70952 WP_000394983.1.70967 WP_000394983.1.71024 WP_000394983.1.71042 WP_000394983.1.71062 WP_000394983.1.71099 WP_000394983.1.71109 WP_000394983.1.71113 WP_000394983.1.71134 WP_000394983.1.71144 WP_000394983.1.71147 WP_000394983.1.71159 WP_000394983.1.71162 WP_000394983.1.71176 WP_000394983.1.71192 WP_000394983.1.71205 WP_000394983.1.7121 WP_000394983.1.71221 WP_000394983.1.71225 WP_000394983.1.71229 WP_000394983.1.71269 WP_000394983.1.71272 WP_000394983.1.71275 WP_000394983.1.71285 WP_000394983.1.71287 WP_000394983.1.71294 WP_000394983.1.71311 WP_000394983.1.71312 WP_000394983.1.71315 WP_000394983.1.71323 WP_000394983.1.71327 WP_000394983.1.71339 WP_000394983.1.71354 WP_000394983.1.71397 WP_000394983.1.71403 WP_000394983.1.71405 WP_000394983.1.71421 WP_000394983.1.71423 WP_000394983.1.71448 WP_000394983.1.71480 WP_000394983.1.71537 WP_000394983.1.71538 WP_000394983.1.71540 WP_000394983.1.71562 WP_000394983.1.71563 WP_000394983.1.71603 WP_000394983.1.71607 WP_000394983.1.71632 WP_000394983.1.71680 WP_000394983.1.71690 WP_000394983.1.71695 WP_000394983.1.71712 WP_000394983.1.71732 WP_000394983.1.71767 WP_000394983.1.71783 WP_000394983.1.71830 WP_000394983.1.71837 WP_000394983.1.71840 WP_000394983.1.71855 WP_000394983.1.71856 WP_000394983.1.71874 WP_000394983.1.7192 WP_000394983.1.71938 WP_000394983.1.71939 WP_000394983.1.71940 WP_000394983.1.71944 WP_000394983.1.71967 WP_000394983.1.71972 WP_000394983.1.71975 WP_000394983.1.71987 WP_000394983.1.71993 WP_000394983.1.72013 WP_000394983.1.72021 WP_000394983.1.72028 WP_000394983.1.72033 WP_000394983.1.72048 WP_000394983.1.7205 WP_000394983.1.72066 WP_000394983.1.72098 WP_000394983.1.7210 WP_000394983.1.72117 WP_000394983.1.72125 WP_000394983.1.72153 WP_000394983.1.72157 WP_000394983.1.72161 WP_000394983.1.72180 WP_000394983.1.72184 WP_000394983.1.72212 WP_000394983.1.72237 WP_000394983.1.72240 WP_000394983.1.72248 WP_000394983.1.7225 WP_000394983.1.72258 WP_000394983.1.72261 WP_000394983.1.72270 WP_000394983.1.72279 WP_000394983.1.72298 WP_000394983.1.723 WP_000394983.1.72322 WP_000394983.1.72337 WP_000394983.1.72352 WP_000394983.1.72359 WP_000394983.1.72388 WP_000394983.1.72397 WP_000394983.1.72425 WP_000394983.1.72427 WP_000394983.1.72431 WP_000394983.1.72436 WP_000394983.1.72469 WP_000394983.1.72485 WP_000394983.1.72493 WP_000394983.1.72511 WP_000394983.1.72522 WP_000394983.1.72537 WP_000394983.1.72544 WP_000394983.1.72551 WP_000394983.1.72582 WP_000394983.1.72588 WP_000394983.1.72596 WP_000394983.1.72599 WP_000394983.1.72606 WP_000394983.1.72614 WP_000394983.1.72616 WP_000394983.1.72619 WP_000394983.1.72641 WP_000394983.1.72643 WP_000394983.1.72663 WP_000394983.1.72694 WP_000394983.1.72695 WP_000394983.1.72700 WP_000394983.1.72706 WP_000394983.1.72725 WP_000394983.1.72729 WP_000394983.1.72745 WP_000394983.1.72747 WP_000394983.1.72751 WP_000394983.1.72758 WP_000394983.1.72764 WP_000394983.1.7277 WP_000394983.1.72778 WP_000394983.1.72806 WP_000394983.1.7281 WP_000394983.1.72857 WP_000394983.1.72858 WP_000394983.1.72860 WP_000394983.1.72869 WP_000394983.1.7291 WP_000394983.1.72910 WP_000394983.1.72913 WP_000394983.1.72947 WP_000394983.1.72950 WP_000394983.1.72956 WP_000394983.1.72962 WP_000394983.1.73010 WP_000394983.1.73032 WP_000394983.1.73072 WP_000394983.1.73075 WP_000394983.1.73085 WP_000394983.1.7309 WP_000394983.1.73126 WP_000394983.1.73197 WP_000394983.1.73215 WP_000394983.1.73217 WP_000394983.1.73230 WP_000394983.1.73243 WP_000394983.1.73249 WP_000394983.1.73251 WP_000394983.1.73257 WP_000394983.1.73259 WP_000394983.1.73283 WP_000394983.1.73291 WP_000394983.1.73292 WP_000394983.1.73295 WP_000394983.1.73326 WP_000394983.1.73340 WP_000394983.1.73343 WP_000394983.1.73344 WP_000394983.1.73349 WP_000394983.1.73385 WP_000394983.1.73428 WP_000394983.1.73430 WP_000394983.1.7345 WP_000394983.1.73468 WP_000394983.1.73486 WP_000394983.1.7349 WP_000394983.1.73524 WP_000394983.1.73565 WP_000394983.1.73572 WP_000394983.1.73604 WP_000394983.1.73626 WP_000394983.1.73663 WP_000394983.1.73700 WP_000394983.1.73709 WP_000394983.1.73717 WP_000394983.1.73748 WP_000394983.1.7376 WP_000394983.1.73783 WP_000394983.1.73785 WP_000394983.1.73797 WP_000394983.1.73801 WP_000394983.1.73807 WP_000394983.1.73811 WP_000394983.1.73827 WP_000394983.1.73835 WP_000394983.1.73844 WP_000394983.1.73859 WP_000394983.1.73897 WP_000394983.1.73908 WP_000394983.1.7392 WP_000394983.1.73934 WP_000394983.1.73942 WP_000394983.1.73968 WP_000394983.1.73992 WP_000394983.1.73995 WP_000394983.1.73996 WP_000394983.1.74032 WP_000394983.1.74041 WP_000394983.1.74045 WP_000394983.1.74046 WP_000394983.1.74051 WP_000394983.1.7407 WP_000394983.1.7411 WP_000394983.1.74123 WP_000394983.1.7413 WP_000394983.1.74156 WP_000394983.1.74184 WP_000394983.1.74185 WP_000394983.1.7424 WP_000394983.1.74243 WP_000394983.1.74251 WP_000394983.1.74267 WP_000394983.1.7429 WP_000394983.1.74309 WP_000394983.1.74358 WP_000394983.1.74365 WP_000394983.1.744 WP_000394983.1.74423 WP_000394983.1.74431 WP_000394983.1.74444 WP_000394983.1.74445 WP_000394983.1.7446 WP_000394983.1.74478 WP_000394983.1.74491 WP_000394983.1.74513 WP_000394983.1.74520 WP_000394983.1.74521 WP_000394983.1.74528 WP_000394983.1.74532 WP_000394983.1.74536 WP_000394983.1.74549 WP_000394983.1.74557 WP_000394983.1.74574 WP_000394983.1.7461 WP_000394983.1.74611 WP_000394983.1.74623 WP_000394983.1.74624 WP_000394983.1.74625 WP_000394983.1.74631 WP_000394983.1.74670 WP_000394983.1.74682 WP_000394983.1.74687 WP_000394983.1.74688 WP_000394983.1.74689 WP_000394983.1.74691 WP_000394983.1.74705 WP_000394983.1.74713 WP_000394983.1.74720 WP_000394983.1.74735 WP_000394983.1.7475 WP_000394983.1.74752 WP_000394983.1.74765 WP_000394983.1.74767 WP_000394983.1.7478 WP_000394983.1.7479 WP_000394983.1.74811 WP_000394983.1.74828 WP_000394983.1.74844 WP_000394983.1.74852 WP_000394983.1.74854 WP_000394983.1.74885 WP_000394983.1.74895 WP_000394983.1.74904 WP_000394983.1.74915 WP_000394983.1.74962 WP_000394983.1.74993 WP_000394983.1.74998 WP_000394983.1.75021 WP_000394983.1.75030 WP_000394983.1.75050 WP_000394983.1.75087 WP_000394983.1.75100 WP_000394983.1.75112 WP_000394983.1.75118 WP_000394983.1.75136 WP_000394983.1.75139 WP_000394983.1.75145 WP_000394983.1.75149 WP_000394983.1.75155 WP_000394983.1.7516 WP_000394983.1.75164 WP_000394983.1.75181 WP_000394983.1.75209 WP_000394983.1.75243 WP_000394983.1.75270 WP_000394983.1.75272 WP_000394983.1.75306 WP_000394983.1.75367 WP_000394983.1.75382 WP_000394983.1.7539 WP_000394983.1.75419 WP_000394983.1.75428 WP_000394983.1.75435 WP_000394983.1.75465 WP_000394983.1.75491 WP_000394983.1.75507 WP_000394983.1.75515 WP_000394983.1.75536 WP_000394983.1.75537 WP_000394983.1.75577 WP_000394983.1.75588 WP_000394983.1.75594 WP_000394983.1.75612 WP_000394983.1.75629 WP_000394983.1.75644 WP_000394983.1.75653 WP_000394983.1.75672 WP_000394983.1.75676 WP_000394983.1.75679 WP_000394983.1.75687 WP_000394983.1.75694 WP_000394983.1.75696 WP_000394983.1.75699 WP_000394983.1.75725 WP_000394983.1.75735 WP_000394983.1.75767 WP_000394983.1.75786 WP_000394983.1.75808 WP_000394983.1.7583 WP_000394983.1.75839 WP_000394983.1.75892 WP_000394983.1.75918 WP_000394983.1.75922 WP_000394983.1.7597 WP_000394983.1.75973 WP_000394983.1.75983 WP_000394983.1.75989 WP_000394983.1.75995 WP_000394983.1.75999 WP_000394983.1.76009 WP_000394983.1.76019 WP_000394983.1.7603 WP_000394983.1.76030 WP_000394983.1.76036 WP_000394983.1.76039 WP_000394983.1.76054 WP_000394983.1.76057 WP_000394983.1.76087 WP_000394983.1.76103 WP_000394983.1.76129 WP_000394983.1.7613 WP_000394983.1.76152 WP_000394983.1.76184 WP_000394983.1.76189 WP_000394983.1.76194 WP_000394983.1.76196 WP_000394983.1.76211 WP_000394983.1.76237 WP_000394983.1.76268 WP_000394983.1.76269 WP_000394983.1.76305 WP_000394983.1.76312 WP_000394983.1.76335 WP_000394983.1.76361 WP_000394983.1.76384 WP_000394983.1.76387 WP_000394983.1.76407 WP_000394983.1.76446 WP_000394983.1.76448 WP_000394983.1.76452 WP_000394983.1.76462 WP_000394983.1.76469 WP_000394983.1.76477 WP_000394983.1.76504 WP_000394983.1.76542 WP_000394983.1.76547 WP_000394983.1.76596 WP_000394983.1.7661 WP_000394983.1.76619 WP_000394983.1.76643 WP_000394983.1.76656 WP_000394983.1.76660 WP_000394983.1.76697 WP_000394983.1.76701 WP_000394983.1.76707 WP_000394983.1.76712 WP_000394983.1.76751 WP_000394983.1.76759 WP_000394983.1.7680 WP_000394983.1.76815 WP_000394983.1.76827 WP_000394983.1.76831 WP_000394983.1.76863 WP_000394983.1.76909 WP_000394983.1.76918 WP_000394983.1.76933 WP_000394983.1.76948 WP_000394983.1.76961 WP_000394983.1.76965 WP_000394983.1.76966 WP_000394983.1.7699 WP_000394983.1.76994 WP_000394983.1.77007 WP_000394983.1.77022 WP_000394983.1.77036 WP_000394983.1.77057 WP_000394983.1.77070 WP_000394983.1.77081 WP_000394983.1.77099 WP_000394983.1.771 WP_000394983.1.77109 WP_000394983.1.77128 WP_000394983.1.77162 WP_000394983.1.77173 WP_000394983.1.77175 WP_000394983.1.77200 WP_000394983.1.77214 WP_000394983.1.77224 WP_000394983.1.77239 WP_000394983.1.77255 WP_000394983.1.77258 WP_000394983.1.77275 WP_000394983.1.7729 WP_000394983.1.77320 WP_000394983.1.77326 WP_000394983.1.77341 WP_000394983.1.77358 WP_000394983.1.77392 WP_000394983.1.77408 WP_000394983.1.77419 WP_000394983.1.77432 WP_000394983.1.77437 WP_000394983.1.77452 WP_000394983.1.77455 WP_000394983.1.77462 WP_000394983.1.7747 WP_000394983.1.77470 WP_000394983.1.77477 WP_000394983.1.77481 WP_000394983.1.77487 WP_000394983.1.77495 WP_000394983.1.775 WP_000394983.1.7750 WP_000394983.1.77511 WP_000394983.1.77542 WP_000394983.1.77551 WP_000394983.1.77577 WP_000394983.1.77595 WP_000394983.1.77608 WP_000394983.1.77626 WP_000394983.1.77632 WP_000394983.1.77636 WP_000394983.1.77643 WP_000394983.1.77644 WP_000394983.1.77648 WP_000394983.1.77707 WP_000394983.1.7775 WP_000394983.1.77760 WP_000394983.1.77767 WP_000394983.1.77768 WP_000394983.1.7780 WP_000394983.1.7781 WP_000394983.1.77816 WP_000394983.1.77826 WP_000394983.1.77833 WP_000394983.1.77876 WP_000394983.1.77929 WP_000394983.1.77950 WP_000394983.1.77961 WP_000394983.1.77979 WP_000394983.1.7799 WP_000394983.1.77999 WP_000394983.1.78000 WP_000394983.1.78007 WP_000394983.1.78010 WP_000394983.1.7808 WP_000394983.1.78089 WP_000394983.1.78097 WP_000394983.1.78101 WP_000394983.1.78131 WP_000394983.1.78183 WP_000394983.1.78187 WP_000394983.1.78196 WP_000394983.1.78232 WP_000394983.1.78233 WP_000394983.1.78235 WP_000394983.1.78297 WP_000394983.1.78305 WP_000394983.1.78321 WP_000394983.1.78323 WP_000394983.1.78368 WP_000394983.1.78376 WP_000394983.1.784 WP_000394983.1.78413 WP_000394983.1.78445 WP_000394983.1.78453 WP_000394983.1.78463 WP_000394983.1.7847 WP_000394983.1.78477 WP_000394983.1.78481 WP_000394983.1.78491 WP_000394983.1.78512 WP_000394983.1.78515 WP_000394983.1.7855 WP_000394983.1.78575 WP_000394983.1.78583 WP_000394983.1.78586 WP_000394983.1.78593 WP_000394983.1.78610 WP_000394983.1.78611 WP_000394983.1.78612 WP_000394983.1.78615 WP_000394983.1.78622 WP_000394983.1.78645 WP_000394983.1.78677 WP_000394983.1.78683 WP_000394983.1.78689 WP_000394983.1.78698 WP_000394983.1.78714 WP_000394983.1.78750 WP_000394983.1.78757 WP_000394983.1.78773 WP_000394983.1.78775 WP_000394983.1.78791 WP_000394983.1.78814 WP_000394983.1.78843 WP_000394983.1.78845 WP_000394983.1.78854 WP_000394983.1.78888 WP_000394983.1.78891 WP_000394983.1.78893 WP_000394983.1.78895 WP_000394983.1.78908 WP_000394983.1.78953 WP_000394983.1.78955 WP_000394983.1.7896 WP_000394983.1.78966 WP_000394983.1.7898 WP_000394983.1.79001 WP_000394983.1.79004 WP_000394983.1.7901 WP_000394983.1.79065 WP_000394983.1.79075 WP_000394983.1.79086 WP_000394983.1.79092 WP_000394983.1.79100 WP_000394983.1.79126 WP_000394983.1.79172 WP_000394983.1.79233 WP_000394983.1.79243 WP_000394983.1.79246 WP_000394983.1.79276 WP_000394983.1.79306 WP_000394983.1.79312 WP_000394983.1.79342 WP_000394983.1.79343 WP_000394983.1.79346 WP_000394983.1.79365 WP_000394983.1.79368 WP_000394983.1.79369 WP_000394983.1.7937 WP_000394983.1.79391 WP_000394983.1.7940 WP_000394983.1.79409 WP_000394983.1.79443 WP_000394983.1.79478 WP_000394983.1.79505 WP_000394983.1.79519 WP_000394983.1.79525 WP_000394983.1.79526 WP_000394983.1.79528 WP_000394983.1.79540 WP_000394983.1.79558 WP_000394983.1.79576 WP_000394983.1.79591 WP_000394983.1.79606 WP_000394983.1.79619 WP_000394983.1.79685 WP_000394983.1.79707 WP_000394983.1.79713 WP_000394983.1.79715 WP_000394983.1.79749 WP_000394983.1.79759 WP_000394983.1.79764 WP_000394983.1.79800 WP_000394983.1.79824 WP_000394983.1.79840 WP_000394983.1.7985 WP_000394983.1.79866 WP_000394983.1.79869 WP_000394983.1.7987 WP_000394983.1.79871 WP_000394983.1.79905 WP_000394983.1.7993 WP_000394983.1.79931 WP_000394983.1.79932 WP_000394983.1.79933 WP_000394983.1.79936 WP_000394983.1.79944 WP_000394983.1.79955 WP_000394983.1.79965 WP_000394983.1.79973 WP_000394983.1.79984 WP_000394983.1.79995 WP_000394983.1.80 WP_000394983.1.80016 WP_000394983.1.80026 WP_000394983.1.8004 WP_000394983.1.80043 WP_000394983.1.80050 WP_000394983.1.80060 WP_000394983.1.80063 WP_000394983.1.8007 WP_000394983.1.80071 WP_000394983.1.80096 WP_000394983.1.80112 WP_000394983.1.80136 WP_000394983.1.80141 WP_000394983.1.80168 WP_000394983.1.80176 WP_000394983.1.80179 WP_000394983.1.80183 WP_000394983.1.80255 WP_000394983.1.80309 WP_000394983.1.80320 WP_000394983.1.80330 WP_000394983.1.80343 WP_000394983.1.804 WP_000394983.1.80402 WP_000394983.1.80428 WP_000394983.1.80440 WP_000394983.1.80444 WP_000394983.1.80484 WP_000394983.1.80517 WP_000394983.1.80519 WP_000394983.1.80524 WP_000394983.1.80558 WP_000394983.1.80559 WP_000394983.1.8057 WP_000394983.1.80578 WP_000394983.1.80606 WP_000394983.1.80612 WP_000394983.1.80626 WP_000394983.1.80660 WP_000394983.1.80662 WP_000394983.1.80666 WP_000394983.1.80709 WP_000394983.1.80718 WP_000394983.1.80736 WP_000394983.1.80753 WP_000394983.1.80754 WP_000394983.1.80756 WP_000394983.1.80768 WP_000394983.1.80789 WP_000394983.1.80804 WP_000394983.1.80805 WP_000394983.1.80862 WP_000394983.1.80884 WP_000394983.1.80894 WP_000394983.1.80935 WP_000394983.1.80945 WP_000394983.1.80946 WP_000394983.1.80948 WP_000394983.1.80983 WP_000394983.1.80985 WP_000394983.1.810 WP_000394983.1.81026 WP_000394983.1.81032 WP_000394983.1.81034 WP_000394983.1.81054 WP_000394983.1.81056 WP_000394983.1.81070 WP_000394983.1.81098 WP_000394983.1.811 WP_000394983.1.81104 WP_000394983.1.81120 WP_000394983.1.81141 WP_000394983.1.81160 WP_000394983.1.81165 WP_000394983.1.81182 WP_000394983.1.81186 WP_000394983.1.81219 WP_000394983.1.81266 WP_000394983.1.81286 WP_000394983.1.8129 WP_000394983.1.81313 WP_000394983.1.81316 WP_000394983.1.81323 WP_000394983.1.81347 WP_000394983.1.81376 WP_000394983.1.81396 WP_000394983.1.814 WP_000394983.1.81418 WP_000394983.1.81420 WP_000394983.1.81423 WP_000394983.1.81438 WP_000394983.1.81442 WP_000394983.1.81469 WP_000394983.1.81475 WP_000394983.1.81514 WP_000394983.1.81517 WP_000394983.1.81576 WP_000394983.1.81577 WP_000394983.1.81580 WP_000394983.1.81588 WP_000394983.1.81589 WP_000394983.1.81596 WP_000394983.1.81618 WP_000394983.1.81624 WP_000394983.1.81688 WP_000394983.1.81715 WP_000394983.1.81723 WP_000394983.1.81754 WP_000394983.1.81761 WP_000394983.1.81806 WP_000394983.1.81819 WP_000394983.1.8183 WP_000394983.1.81832 WP_000394983.1.81843 WP_000394983.1.81869 WP_000394983.1.81873 WP_000394983.1.81888 WP_000394983.1.81914 WP_000394983.1.81935 WP_000394983.1.81939 WP_000394983.1.81975 WP_000394983.1.82 WP_000394983.1.82008 WP_000394983.1.82010 WP_000394983.1.82057 WP_000394983.1.82059 WP_000394983.1.82104 WP_000394983.1.82106 WP_000394983.1.82123 WP_000394983.1.82137 WP_000394983.1.82166 WP_000394983.1.82217 WP_000394983.1.82239 WP_000394983.1.82240 WP_000394983.1.82246 WP_000394983.1.82296 WP_000394983.1.82316 WP_000394983.1.82326 WP_000394983.1.8235 WP_000394983.1.82378 WP_000394983.1.82439 WP_000394983.1.82485 WP_000394983.1.82499 WP_000394983.1.82527 WP_000394983.1.82536 WP_000394983.1.82539 WP_000394983.1.8255 WP_000394983.1.82572 WP_000394983.1.82589 WP_000394983.1.82594 WP_000394983.1.82626 WP_000394983.1.82629 WP_000394983.1.82647 WP_000394983.1.82661 WP_000394983.1.8268 WP_000394983.1.82682 WP_000394983.1.82698 WP_000394983.1.82715 WP_000394983.1.82718 WP_000394983.1.82747 WP_000394983.1.82754 WP_000394983.1.82780 WP_000394983.1.82784 WP_000394983.1.82797 WP_000394983.1.82799 WP_000394983.1.82808 WP_000394983.1.82816 WP_000394983.1.82820 WP_000394983.1.82831 WP_000394983.1.82853 WP_000394983.1.82902 WP_000394983.1.82923 WP_000394983.1.8295 WP_000394983.1.83020 WP_000394983.1.83035 WP_000394983.1.83036 WP_000394983.1.83051 WP_000394983.1.83059 WP_000394983.1.8306 WP_000394983.1.8308 WP_000394983.1.83093 WP_000394983.1.83097 WP_000394983.1.83099 WP_000394983.1.831 WP_000394983.1.83118 WP_000394983.1.83125 WP_000394983.1.83127 WP_000394983.1.83140 WP_000394983.1.83144 WP_000394983.1.83151 WP_000394983.1.83214 WP_000394983.1.83218 WP_000394983.1.83224 WP_000394983.1.83253 WP_000394983.1.83256 WP_000394983.1.83313 WP_000394983.1.83347 WP_000394983.1.83375 WP_000394983.1.83393 WP_000394983.1.83415 WP_000394983.1.8345 WP_000394983.1.83481 WP_000394983.1.83506 WP_000394983.1.83537 WP_000394983.1.83544 WP_000394983.1.83564 WP_000394983.1.83582 WP_000394983.1.83584 WP_000394983.1.83644 WP_000394983.1.83660 WP_000394983.1.83668 WP_000394983.1.8368 WP_000394983.1.83684 WP_000394983.1.83712 WP_000394983.1.83735 WP_000394983.1.83762 WP_000394983.1.83781 WP_000394983.1.83820 WP_000394983.1.8386 WP_000394983.1.83879 WP_000394983.1.83911 WP_000394983.1.83936 WP_000394983.1.83941 WP_000394983.1.83947 WP_000394983.1.84004 WP_000394983.1.84014 WP_000394983.1.84021 WP_000394983.1.8405 WP_000394983.1.84060 WP_000394983.1.8408 WP_000394983.1.8411 WP_000394983.1.84140 WP_000394983.1.84172 WP_000394983.1.84185 WP_000394983.1.84197 WP_000394983.1.84210 WP_000394983.1.84215 WP_000394983.1.84219 WP_000394983.1.84264 WP_000394983.1.84298 WP_000394983.1.84312 WP_000394983.1.84313 WP_000394983.1.84316 WP_000394983.1.84319 WP_000394983.1.84326 WP_000394983.1.84331 WP_000394983.1.84339 WP_000394983.1.84402 WP_000394983.1.84405 WP_000394983.1.84410 WP_000394983.1.8444 WP_000394983.1.84464 WP_000394983.1.84467 WP_000394983.1.8447 WP_000394983.1.84473 WP_000394983.1.84476 WP_000394983.1.84482 WP_000394983.1.84486 WP_000394983.1.84511 WP_000394983.1.84531 WP_000394983.1.84534 WP_000394983.1.84584 WP_000394983.1.84635 WP_000394983.1.84639 WP_000394983.1.84656 WP_000394983.1.84657 WP_000394983.1.84675 WP_000394983.1.8470 WP_000394983.1.84731 WP_000394983.1.84738 WP_000394983.1.84740 WP_000394983.1.8477 WP_000394983.1.84797 WP_000394983.1.84841 WP_000394983.1.84850 WP_000394983.1.84875 WP_000394983.1.84877 WP_000394983.1.84878 WP_000394983.1.84881 WP_000394983.1.84916 WP_000394983.1.84941 WP_000394983.1.84948 WP_000394983.1.84966 WP_000394983.1.84972 WP_000394983.1.84977 WP_000394983.1.84994 WP_000394983.1.85002 WP_000394983.1.85011 WP_000394983.1.85025 WP_000394983.1.85048 WP_000394983.1.85052 WP_000394983.1.85077 WP_000394983.1.85090 WP_000394983.1.85098 WP_000394983.1.85105 WP_000394983.1.85112 WP_000394983.1.85125 WP_000394983.1.85129 WP_000394983.1.85138 WP_000394983.1.85155 WP_000394983.1.85175 WP_000394983.1.85188 WP_000394983.1.85241 WP_000394983.1.85247 WP_000394983.1.85252 WP_000394983.1.85253 WP_000394983.1.85255 WP_000394983.1.85260 WP_000394983.1.85320 WP_000394983.1.85323 WP_000394983.1.85329 WP_000394983.1.85335 WP_000394983.1.85342 WP_000394983.1.85361 WP_000394983.1.85435 WP_000394983.1.85504 WP_000394983.1.85546 WP_000394983.1.85554 WP_000394983.1.85556 WP_000394983.1.85558 WP_000394983.1.85563 WP_000394983.1.85578 WP_000394983.1.85593 WP_000394983.1.8560 WP_000394983.1.85601 WP_000394983.1.85621 WP_000394983.1.85623 WP_000394983.1.85657 WP_000394983.1.85722 WP_000394983.1.85762 WP_000394983.1.85772 WP_000394983.1.85773 WP_000394983.1.85781 WP_000394983.1.85857 WP_000394983.1.8592 WP_000394983.1.85939 WP_000394983.1.85944 WP_000394983.1.85948 WP_000394983.1.86001 WP_000394983.1.86035 WP_000394983.1.8607 WP_000394983.1.86104 WP_000394983.1.86105 WP_000394983.1.86115 WP_000394983.1.86145 WP_000394983.1.86149 WP_000394983.1.86166 WP_000394983.1.86171 WP_000394983.1.86179 WP_000394983.1.86181 WP_000394983.1.86189 WP_000394983.1.86196 WP_000394983.1.8621 WP_000394983.1.86210 WP_000394983.1.86227 WP_000394983.1.86228 WP_000394983.1.86234 WP_000394983.1.86255 WP_000394983.1.86261 WP_000394983.1.86263 WP_000394983.1.86266 WP_000394983.1.86273 WP_000394983.1.86276 WP_000394983.1.86280 WP_000394983.1.86283 WP_000394983.1.86307 WP_000394983.1.86340 WP_000394983.1.8635 WP_000394983.1.86353 WP_000394983.1.86355 WP_000394983.1.86364 WP_000394983.1.86371 WP_000394983.1.86376 WP_000394983.1.86393 WP_000394983.1.86411 WP_000394983.1.86412 WP_000394983.1.86437 WP_000394983.1.86451 WP_000394983.1.86452 WP_000394983.1.86454 WP_000394983.1.86461 WP_000394983.1.86475 WP_000394983.1.86492 WP_000394983.1.8652 WP_000394983.1.8656 WP_000394983.1.86560 WP_000394983.1.86574 WP_000394983.1.86583 WP_000394983.1.86586 WP_000394983.1.86598 WP_000394983.1.86609 WP_000394983.1.86613 WP_000394983.1.86617 WP_000394983.1.86627 WP_000394983.1.86640 WP_000394983.1.86667 WP_000394983.1.86673 WP_000394983.1.86674 WP_000394983.1.86681 WP_000394983.1.86691 WP_000394983.1.86727 WP_000394983.1.86734 WP_000394983.1.86760 WP_000394983.1.86787 WP_000394983.1.86788 WP_000394983.1.86833 WP_000394983.1.8687 WP_000394983.1.86935 WP_000394983.1.86956 WP_000394983.1.86959 WP_000394983.1.86975 WP_000394983.1.86994 WP_000394983.1.86997 WP_000394983.1.87043 WP_000394983.1.8705 WP_000394983.1.87067 WP_000394983.1.87075 WP_000394983.1.87076 WP_000394983.1.87102 WP_000394983.1.87109 WP_000394983.1.8711 WP_000394983.1.87177 WP_000394983.1.87189 WP_000394983.1.87199 WP_000394983.1.87205 WP_000394983.1.87247 WP_000394983.1.87249 WP_000394983.1.87254 WP_000394983.1.87310 WP_000394983.1.87339 WP_000394983.1.87358 WP_000394983.1.87371 WP_000394983.1.87389 WP_000394983.1.87400 WP_000394983.1.87410 WP_000394983.1.87443 WP_000394983.1.87491 WP_000394983.1.87504 WP_000394983.1.87557 WP_000394983.1.87563 WP_000394983.1.87568 WP_000394983.1.87574 WP_000394983.1.87581 WP_000394983.1.87590 WP_000394983.1.87607 WP_000394983.1.87610 WP_000394983.1.87616 WP_000394983.1.87633 WP_000394983.1.87639 WP_000394983.1.87655 WP_000394983.1.87675 WP_000394983.1.87694 WP_000394983.1.87726 WP_000394983.1.87728 WP_000394983.1.87738 WP_000394983.1.87766 WP_000394983.1.8778 WP_000394983.1.87788 WP_000394983.1.87789 WP_000394983.1.87834 WP_000394983.1.87883 WP_000394983.1.87914 WP_000394983.1.87919 WP_000394983.1.87973 WP_000394983.1.87980 WP_000394983.1.87989 WP_000394983.1.87990 WP_000394983.1.880 WP_000394983.1.88017 WP_000394983.1.88020 WP_000394983.1.8807 WP_000394983.1.88082 WP_000394983.1.88088 WP_000394983.1.88110 WP_000394983.1.88119 WP_000394983.1.88147 WP_000394983.1.88149 WP_000394983.1.88155 WP_000394983.1.88234 WP_000394983.1.88238 WP_000394983.1.88252 WP_000394983.1.88260 WP_000394983.1.88301 WP_000394983.1.88304 WP_000394983.1.88336 WP_000394983.1.88376 WP_000394983.1.88379 WP_000394983.1.88384 WP_000394983.1.88427 WP_000394983.1.8843 WP_000394983.1.88434 WP_000394983.1.88462 WP_000394983.1.88467 WP_000394983.1.88499 WP_000394983.1.88524 WP_000394983.1.88527 WP_000394983.1.88528 WP_000394983.1.88535 WP_000394983.1.88539 WP_000394983.1.8855 WP_000394983.1.88562 WP_000394983.1.88603 WP_000394983.1.88631 WP_000394983.1.88667 WP_000394983.1.88678 WP_000394983.1.88686 WP_000394983.1.88710 WP_000394983.1.88711 WP_000394983.1.88720 WP_000394983.1.88729 WP_000394983.1.88732 WP_000394983.1.88752 WP_000394983.1.88759 WP_000394983.1.88767 WP_000394983.1.8879 WP_000394983.1.88793 WP_000394983.1.88803 WP_000394983.1.88826 WP_000394983.1.88834 WP_000394983.1.88883 WP_000394983.1.88891 WP_000394983.1.88941 WP_000394983.1.88950 WP_000394983.1.88961 WP_000394983.1.88997 WP_000394983.1.89043 WP_000394983.1.89050 WP_000394983.1.8906 WP_000394983.1.89067 WP_000394983.1.89090 WP_000394983.1.89099 WP_000394983.1.89150 WP_000394983.1.89183 WP_000394983.1.89197 WP_000394983.1.89200 WP_000394983.1.89203 WP_000394983.1.89214 WP_000394983.1.89217 WP_000394983.1.89285 WP_000394983.1.89305 WP_000394983.1.89322 WP_000394983.1.89334 WP_000394983.1.89335 WP_000394983.1.89351 WP_000394983.1.89379 WP_000394983.1.8938 WP_000394983.1.89385 WP_000394983.1.89396 WP_000394983.1.89400 WP_000394983.1.89405 WP_000394983.1.89416 WP_000394983.1.89427 WP_000394983.1.89432 WP_000394983.1.8945 WP_000394983.1.89455 WP_000394983.1.89458 WP_000394983.1.89466 WP_000394983.1.89468 WP_000394983.1.89469 WP_000394983.1.89471 WP_000394983.1.89474 WP_000394983.1.89479 WP_000394983.1.89492 WP_000394983.1.89569 WP_000394983.1.89583 WP_000394983.1.89601 WP_000394983.1.89627 WP_000394983.1.89631 WP_000394983.1.89646 WP_000394983.1.89656 WP_000394983.1.89674 WP_000394983.1.89679 WP_000394983.1.89700 WP_000394983.1.89710 WP_000394983.1.89747 WP_000394983.1.89768 WP_000394983.1.89781 WP_000394983.1.89788 WP_000394983.1.89818 WP_000394983.1.89839 WP_000394983.1.89852 WP_000394983.1.89859 WP_000394983.1.89879 WP_000394983.1.89895 WP_000394983.1.89899 WP_000394983.1.89915 WP_000394983.1.89917 WP_000394983.1.89920 WP_000394983.1.89923 WP_000394983.1.89927 WP_000394983.1.89977 WP_000394983.1.89988 WP_000394983.1.90017 WP_000394983.1.90050 WP_000394983.1.90063 WP_000394983.1.90078 WP_000394983.1.9009 WP_000394983.1.9010 WP_000394983.1.90115 WP_000394983.1.90128 WP_000394983.1.90139 WP_000394983.1.90156 WP_000394983.1.90168 WP_000394983.1.90171 WP_000394983.1.90182 WP_000394983.1.90205 WP_000394983.1.90219 WP_000394983.1.90256 WP_000394983.1.90257 WP_000394983.1.90266 WP_000394983.1.90270 WP_000394983.1.90332 WP_000394983.1.90342 WP_000394983.1.90346 WP_000394983.1.90349 WP_000394983.1.90357 WP_000394983.1.90358 WP_000394983.1.9036 WP_000394983.1.9037 WP_000394983.1.90389 WP_000394983.1.90405 WP_000394983.1.90435 WP_000394983.1.90441 WP_000394983.1.90449 WP_000394983.1.90467 WP_000394983.1.90511 WP_000394983.1.90520 WP_000394983.1.90536 WP_000394983.1.90542 WP_000394983.1.9059 WP_000394983.1.90591 WP_000394983.1.90602 WP_000394983.1.9061 WP_000394983.1.90626 WP_000394983.1.90690 WP_000394983.1.90703 WP_000394983.1.90706 WP_000394983.1.90799 WP_000394983.1.9081 WP_000394983.1.90822 WP_000394983.1.90828 WP_000394983.1.90834 WP_000394983.1.90839 WP_000394983.1.90842 WP_000394983.1.90844 WP_000394983.1.90848 WP_000394983.1.90856 WP_000394983.1.90864 WP_000394983.1.90873 WP_000394983.1.90890 WP_000394983.1.909 WP_000394983.1.90905 WP_000394983.1.90951 WP_000394983.1.90960 WP_000394983.1.90979 WP_000394983.1.90988 WP_000394983.1.90996 WP_000394983.1.90997 WP_000394983.1.91007 WP_000394983.1.91010 WP_000394983.1.91018 WP_000394983.1.91072 WP_000394983.1.91088 WP_000394983.1.91117 WP_000394983.1.91121 WP_000394983.1.91143 WP_000394983.1.91153 WP_000394983.1.91170 WP_000394983.1.9119 WP_000394983.1.91213 WP_000394983.1.91220 WP_000394983.1.91266 WP_000394983.1.91268 WP_000394983.1.91277 WP_000394983.1.91288 WP_000394983.1.91290 WP_000394983.1.91340 WP_000394983.1.91341 WP_000394983.1.91354 WP_000394983.1.91356 WP_000394983.1.91361 WP_000394983.1.91384 WP_000394983.1.91425 WP_000394983.1.91445 WP_000394983.1.91462 WP_000394983.1.91482 WP_000394983.1.91485 WP_000394983.1.915 WP_000394983.1.91511 WP_000394983.1.91515 WP_000394983.1.91516 WP_000394983.1.91543 WP_000394983.1.91548 WP_000394983.1.91549 WP_000394983.1.91551 WP_000394983.1.91565 WP_000394983.1.91566 WP_000394983.1.9157 WP_000394983.1.91594 WP_000394983.1.91596 WP_000394983.1.9160 WP_000394983.1.91640 WP_000394983.1.91643 WP_000394983.1.91644 WP_000394983.1.91651 WP_000394983.1.91666 WP_000394983.1.91672 WP_000394983.1.9168 WP_000394983.1.91685 WP_000394983.1.9169 WP_000394983.1.91739 WP_000394983.1.91756 WP_000394983.1.91777 WP_000394983.1.91779 WP_000394983.1.91782 WP_000394983.1.91801 WP_000394983.1.91814 WP_000394983.1.91843 WP_000394983.1.91850 WP_000394983.1.91871 WP_000394983.1.91879 WP_000394983.1.91887 WP_000394983.1.91893 WP_000394983.1.91954 WP_000394983.1.91959 WP_000394983.1.91965 WP_000394983.1.91971 WP_000394983.1.9199 WP_000394983.1.91994 WP_000394983.1.92005 WP_000394983.1.92014 WP_000394983.1.92019 WP_000394983.1.92025 WP_000394983.1.92031 WP_000394983.1.92048 WP_000394983.1.92053 WP_000394983.1.92058 WP_000394983.1.9209 WP_000394983.1.921 WP_000394983.1.92102 WP_000394983.1.92114 WP_000394983.1.9215 WP_000394983.1.92161 WP_000394983.1.92163 WP_000394983.1.92180 WP_000394983.1.92201 WP_000394983.1.92215 WP_000394983.1.92224 WP_000394983.1.92276 WP_000394983.1.92304 WP_000394983.1.92305 WP_000394983.1.92311 WP_000394983.1.92323 WP_000394983.1.92361 WP_000394983.1.92384 WP_000394983.1.92403 WP_000394983.1.92434 WP_000394983.1.92473 WP_000394983.1.92496 WP_000394983.1.92532 WP_000394983.1.9255 WP_000394983.1.92568 WP_000394983.1.92577 WP_000394983.1.92614 WP_000394983.1.92615 WP_000394983.1.92634 WP_000394983.1.92638 WP_000394983.1.9264 WP_000394983.1.92648 WP_000394983.1.9266 WP_000394983.1.92693 WP_000394983.1.92719 WP_000394983.1.92742 WP_000394983.1.92767 WP_000394983.1.92780 WP_000394983.1.92792 WP_000394983.1.92819 WP_000394983.1.92865 WP_000394983.1.92882 WP_000394983.1.92886 WP_000394983.1.92943 WP_000394983.1.92953 WP_000394983.1.93005 WP_000394983.1.93016 WP_000394983.1.93017 WP_000394983.1.93019 WP_000394983.1.93027 WP_000394983.1.93033 WP_000394983.1.93048 WP_000394983.1.93052 WP_000394983.1.93054 WP_000394983.1.93069 WP_000394983.1.93072 WP_000394983.1.93085 WP_000394983.1.93112 WP_000394983.1.93133 WP_000394983.1.93138 WP_000394983.1.93139 WP_000394983.1.93167 WP_000394983.1.93175 WP_000394983.1.93233 WP_000394983.1.93252 WP_000394983.1.9327 WP_000394983.1.93276 WP_000394983.1.93291 WP_000394983.1.93309 WP_000394983.1.9331 WP_000394983.1.93312 WP_000394983.1.93326 WP_000394983.1.93338 WP_000394983.1.93379 WP_000394983.1.93388 WP_000394983.1.934 WP_000394983.1.93428 WP_000394983.1.93453 WP_000394983.1.93461 WP_000394983.1.93463 WP_000394983.1.93464 WP_000394983.1.93509 WP_000394983.1.93531 WP_000394983.1.93533 WP_000394983.1.93552 WP_000394983.1.9356 WP_000394983.1.93601 WP_000394983.1.93629 WP_000394983.1.93630 WP_000394983.1.93634 WP_000394983.1.93637 WP_000394983.1.93639 WP_000394983.1.93652 WP_000394983.1.93665 WP_000394983.1.93670 WP_000394983.1.93673 WP_000394983.1.93679 WP_000394983.1.93694 WP_000394983.1.93695 WP_000394983.1.93733 WP_000394983.1.93737 WP_000394983.1.93743 WP_000394983.1.93745 WP_000394983.1.93755 WP_000394983.1.93765 WP_000394983.1.93821 WP_000394983.1.93873 WP_000394983.1.93877 WP_000394983.1.93911 WP_000394983.1.93918 WP_000394983.1.93922 WP_000394983.1.93939 WP_000394983.1.93951 WP_000394983.1.93952 WP_000394983.1.94008 WP_000394983.1.94011 WP_000394983.1.94028 WP_000394983.1.94040 WP_000394983.1.94057 WP_000394983.1.94069 WP_000394983.1.94156 WP_000394983.1.9416 WP_000394983.1.94176 WP_000394983.1.94187 WP_000394983.1.9420 WP_000394983.1.94213 WP_000394983.1.94232 WP_000394983.1.9426 WP_000394983.1.94271 WP_000394983.1.94282 WP_000394983.1.94298 WP_000394983.1.94302 WP_000394983.1.94317 WP_000394983.1.94343 WP_000394983.1.94353 WP_000394983.1.94367 WP_000394983.1.94388 WP_000394983.1.94404 WP_000394983.1.94417 WP_000394983.1.94436 WP_000394983.1.94438 WP_000394983.1.94445 WP_000394983.1.94446 WP_000394983.1.94468 WP_000394983.1.94475 WP_000394983.1.94507 WP_000394983.1.94542 WP_000394983.1.9457 WP_000394983.1.94578 WP_000394983.1.94580 WP_000394983.1.94589 WP_000394983.1.94619 WP_000394983.1.94626 WP_000394983.1.94676 WP_000394983.1.94686 WP_000394983.1.94692 WP_000394983.1.94695 WP_000394983.1.94704 WP_000394983.1.94738 WP_000394983.1.9474 WP_000394983.1.94754 WP_000394983.1.94764 WP_000394983.1.94787 WP_000394983.1.94790 WP_000394983.1.948 WP_000394983.1.94808 WP_000394983.1.94822 WP_000394983.1.94823 WP_000394983.1.94836 WP_000394983.1.94841 WP_000394983.1.94847 WP_000394983.1.94869 WP_000394983.1.94880 WP_000394983.1.94889 WP_000394983.1.9489 WP_000394983.1.94892 WP_000394983.1.94898 WP_000394983.1.949 WP_000394983.1.94903 WP_000394983.1.9491 WP_000394983.1.94927 WP_000394983.1.94935 WP_000394983.1.94949 WP_000394983.1.94955 WP_000394983.1.94991 WP_000394983.1.94993 WP_000394983.1.94997 WP_000394983.1.95005 WP_000394983.1.95022 WP_000394983.1.95028 WP_000394983.1.95037 WP_000394983.1.95062 WP_000394983.1.95080 WP_000394983.1.95084 WP_000394983.1.95105 WP_000394983.1.95129 WP_000394983.1.9513 WP_000394983.1.95161 WP_000394983.1.95198 WP_000394983.1.95243 WP_000394983.1.95244 WP_000394983.1.95275 WP_000394983.1.95329 WP_000394983.1.95332 WP_000394983.1.95364 WP_000394983.1.95366 WP_000394983.1.95368 WP_000394983.1.95378 WP_000394983.1.95381 WP_000394983.1.95390 WP_000394983.1.95395 WP_000394983.1.95398 WP_000394983.1.95400 WP_000394983.1.95424 WP_000394983.1.95428 WP_000394983.1.95449 WP_000394983.1.95490 WP_000394983.1.95521 WP_000394983.1.95563 WP_000394983.1.9559 WP_000394983.1.95595 WP_000394983.1.95604 WP_000394983.1.95611 WP_000394983.1.95628 WP_000394983.1.95634 WP_000394983.1.95655 WP_000394983.1.9566 WP_000394983.1.95666 WP_000394983.1.95680 WP_000394983.1.95771 WP_000394983.1.95783 WP_000394983.1.95784 WP_000394983.1.95800 WP_000394983.1.95824 WP_000394983.1.95827 WP_000394983.1.95834 WP_000394983.1.95846 WP_000394983.1.95849 WP_000394983.1.95858 WP_000394983.1.95861 WP_000394983.1.95865 WP_000394983.1.95919 WP_000394983.1.95929 WP_000394983.1.95931 WP_000394983.1.95932 WP_000394983.1.960 WP_000394983.1.96053 WP_000394983.1.96066 WP_000394983.1.96097 WP_000394983.1.96114 WP_000394983.1.96143 WP_000394983.1.96145 WP_000394983.1.9616 WP_000394983.1.96177 WP_000394983.1.96215 WP_000394983.1.96222 WP_000394983.1.96223 WP_000394983.1.96229 WP_000394983.1.96247 WP_000394983.1.96253 WP_000394983.1.96263 WP_000394983.1.96290 WP_000394983.1.96299 WP_000394983.1.96303 WP_000394983.1.96339 WP_000394983.1.96341 WP_000394983.1.96378 WP_000394983.1.96394 WP_000394983.1.9641 WP_000394983.1.96417 WP_000394983.1.96425 WP_000394983.1.96450 WP_000394983.1.96457 WP_000394983.1.96478 WP_000394983.1.96479 WP_000394983.1.96484 WP_000394983.1.9649 WP_000394983.1.96494 WP_000394983.1.965 WP_000394983.1.96541 WP_000394983.1.96558 WP_000394983.1.96562 WP_000394983.1.96585 WP_000394983.1.96609 WP_000394983.1.9661 WP_000394983.1.96617 WP_000394983.1.96633 WP_000394983.1.96650 WP_000394983.1.96659 WP_000394983.1.96676 WP_000394983.1.9668 WP_000394983.1.96695 WP_000394983.1.9671 WP_000394983.1.96759 WP_000394983.1.96762 WP_000394983.1.96796 WP_000394983.1.96797 WP_000394983.1.96817 WP_000394983.1.9682 WP_000394983.1.96820 WP_000394983.1.96864 WP_000394983.1.96907 WP_000394983.1.9691 WP_000394983.1.96924 WP_000394983.1.96944 WP_000394983.1.96984 WP_000394983.1.96989 WP_000394983.1.97011 WP_000394983.1.97027 WP_000394983.1.97049 WP_000394983.1.97059 WP_000394983.1.97119 WP_000394983.1.97123 WP_000394983.1.97147 WP_000394983.1.97193 WP_000394983.1.97200 WP_000394983.1.97226 WP_000394983.1.9723 WP_000394983.1.97231 WP_000394983.1.97248 WP_000394983.1.97269 WP_000394983.1.97282 WP_000394983.1.9729 WP_000394983.1.97292 WP_000394983.1.97344 WP_000394983.1.97351 WP_000394983.1.97356 WP_000394983.1.97360 WP_000394983.1.97361 WP_000394983.1.97387 WP_000394983.1.9740 WP_000394983.1.97402 WP_000394983.1.97418 WP_000394983.1.97421 WP_000394983.1.97434 WP_000394983.1.97437 WP_000394983.1.97439 WP_000394983.1.9747 WP_000394983.1.97490 WP_000394983.1.97513 WP_000394983.1.97525 WP_000394983.1.97538 WP_000394983.1.97544 WP_000394983.1.97549 WP_000394983.1.97619 WP_000394983.1.97654 WP_000394983.1.97677 WP_000394983.1.9770 WP_000394983.1.97705 WP_000394983.1.97770 WP_000394983.1.97778 WP_000394983.1.978 WP_000394983.1.97822 WP_000394983.1.97825 WP_000394983.1.97871 WP_000394983.1.97890 WP_000394983.1.97919 WP_000394983.1.97930 WP_000394983.1.97932 WP_000394983.1.97937 WP_000394983.1.97962 WP_000394983.1.97996 WP_000394983.1.98026 WP_000394983.1.9803 WP_000394983.1.98046 WP_000394983.1.98082 WP_000394983.1.98083 WP_000394983.1.981 WP_000394983.1.98102 WP_000394983.1.98115 WP_000394983.1.98139 WP_000394983.1.98155 WP_000394983.1.98167 WP_000394983.1.9817 WP_000394983.1.98176 WP_000394983.1.98202 WP_000394983.1.98205 WP_000394983.1.98220 WP_000394983.1.98232 WP_000394983.1.98235 WP_000394983.1.98241 WP_000394983.1.98244 WP_000394983.1.98251 WP_000394983.1.98279 WP_000394983.1.98292 WP_000394983.1.98294 WP_000394983.1.98301 WP_000394983.1.98312 WP_000394983.1.98357 WP_000394983.1.98384 WP_000394983.1.98400 WP_000394983.1.98404 WP_000394983.1.98424 WP_000394983.1.9844 WP_000394983.1.98442 WP_000394983.1.98477 WP_000394983.1.98480 WP_000394983.1.98484 WP_000394983.1.98543 WP_000394983.1.98549 WP_000394983.1.98569 WP_000394983.1.98578 WP_000394983.1.98626 WP_000394983.1.98628 WP_000394983.1.98633 WP_000394983.1.9864 WP_000394983.1.98654 WP_000394983.1.98665 WP_000394983.1.98668 WP_000394983.1.98683 WP_000394983.1.98702 WP_000394983.1.98727 WP_000394983.1.98757 WP_000394983.1.98775 WP_000394983.1.98776 WP_000394983.1.98795 WP_000394983.1.9883 WP_000394983.1.98920 WP_000394983.1.98976 WP_000394983.1.98988 WP_000394983.1.99006 WP_000394983.1.99029 WP_000394983.1.99046 WP_000394983.1.99060 WP_000394983.1.99101 WP_000394983.1.99168 WP_000394983.1.99182 WP_000394983.1.99209 WP_000394983.1.99234 WP_000394983.1.99246 WP_000394983.1.99265 WP_000394983.1.99292 WP_000394983.1.9930 WP_000394983.1.99302 WP_000394983.1.99304 WP_000394983.1.99306 WP_000394983.1.99307 WP_000394983.1.99310 WP_000394983.1.99319 WP_000394983.1.99345 WP_000394983.1.99349 WP_000394983.1.99366 WP_000394983.1.99392 WP_000394983.1.9940 WP_000394983.1.99400 WP_000394983.1.99401 WP_000394983.1.99446 WP_000394983.1.99453 WP_000394983.1.99471 WP_000394983.1.99472 WP_000394983.1.99475 WP_000394983.1.99486 WP_000394983.1.99487 WP_000394983.1.99498 WP_000394983.1.9950 WP_000394983.1.99501 WP_000394983.1.99511 WP_000394983.1.99534 WP_000394983.1.99549 WP_000394983.1.99571 WP_000394983.1.99592 WP_000394983.1.99602 WP_000394983.1.99603 WP_000394983.1.99619 WP_000394983.1.99632 WP_000394983.1.99666 WP_000394983.1.99692 WP_000394983.1.99694 WP_000394983.1.99734 WP_000394983.1.99782 WP_000394983.1.99804 WP_000394983.1.99827 WP_000394983.1.99869 WP_000394983.1.99874 WP_000394983.1.99929 WP_000394983.1.99986 YP_002412833.1.14968 YP_006120173.1.29421 YP_006778869.1.12065 gi|386629514|ref|YP_006149234.1| gi|15831779|ref|NP_310552.1| gi|215487027|ref|YP_002329458.1| gi|91211033|ref|YP_541019.1| gi|387882922|ref|YP_006313224.1| gi|110641933|ref|YP_669663.1| gi|157161282|ref|YP_001458600.1| gi|387621535|ref|YP_006129162.1| gi|387507061|ref|YP_006159317.1| gi|253773231|ref|YP_003036062.1| gi|170081471|ref|YP_001730791.1| gi|170019839|ref|YP_001724793.1| gi|218558678|ref|YP_002391591.1| gi|251785263|ref|YP_002999567.1| gi|556551799|ref|YP_008721953.1| gi|157157134|ref|YP_001463117.1| gi|383178008|ref|YP_005456013.1| gi|170679631|ref|YP_001743430.1| gi|209919181|ref|YP_002293265.1| gi|16129770|ref|NP_416330.1| gi|544576233|ref|YP_008571757.1| gi|386634434|ref|YP_006154153.1| gi|222156558|ref|YP_002556697.1| gi|117623975|ref|YP_852888.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]