SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15833516|ref|NP_312289.1| from Escherichia coli O157:H7 str. Sakai

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15833516|ref|NP_312289.1|
Domain Number 1 Region: 27-148
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000033
Family N-acetyl transferase, NAT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15833516|ref|NP_312289.1|
Sequence length 161
Comment hypothetical protein ECs4262 [Escherichia coli O157:H7 str. Sakai]
Sequence
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYC
LSTGSIQRNLAPGAMRRNAPESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQ
VGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITLE
Download sequence
Identical sequences A0A024KS15 A0A0B1FM94 A0A0F6CA05 A0A0F6FDB4 A0A0H3PY32 A0A1S9JQG6 A0A1X3LCP3 A0A1Z3UYH7 D3QTN8 F4TLG2 Q8X6Z9
gi|387884569|ref|YP_006314871.1| 155864.Z4777 386585.ECs4262 444450.ECH74115_4727 544404.ECSP_4371 gi|291284757|ref|YP_003501575.1| gi|209399993|ref|YP_002272856.1| NP_312289.1.58667 WP_001301452.1.10001 WP_001301452.1.100073 WP_001301452.1.10010 WP_001301452.1.100299 WP_001301452.1.100302 WP_001301452.1.100508 WP_001301452.1.100554 WP_001301452.1.100925 WP_001301452.1.101105 WP_001301452.1.101166 WP_001301452.1.101206 WP_001301452.1.101628 WP_001301452.1.10206 WP_001301452.1.102094 WP_001301452.1.102139 WP_001301452.1.10273 WP_001301452.1.10335 WP_001301452.1.10476 WP_001301452.1.10569 WP_001301452.1.10761 WP_001301452.1.10970 WP_001301452.1.11068 WP_001301452.1.1111 WP_001301452.1.11240 WP_001301452.1.11301 WP_001301452.1.11420 WP_001301452.1.11671 WP_001301452.1.11690 WP_001301452.1.12259 WP_001301452.1.12305 WP_001301452.1.12352 WP_001301452.1.12552 WP_001301452.1.12646 WP_001301452.1.13060 WP_001301452.1.13217 WP_001301452.1.13223 WP_001301452.1.13332 WP_001301452.1.13348 WP_001301452.1.13430 WP_001301452.1.13442 WP_001301452.1.13481 WP_001301452.1.13881 WP_001301452.1.13936 WP_001301452.1.13939 WP_001301452.1.14110 WP_001301452.1.14453 WP_001301452.1.14621 WP_001301452.1.14748 WP_001301452.1.15356 WP_001301452.1.15503 WP_001301452.1.15527 WP_001301452.1.1559 WP_001301452.1.15626 WP_001301452.1.15702 WP_001301452.1.15782 WP_001301452.1.16075 WP_001301452.1.16133 WP_001301452.1.16222 WP_001301452.1.16272 WP_001301452.1.16463 WP_001301452.1.16481 WP_001301452.1.16845 WP_001301452.1.17187 WP_001301452.1.1731 WP_001301452.1.17386 WP_001301452.1.17415 WP_001301452.1.17515 WP_001301452.1.17904 WP_001301452.1.17937 WP_001301452.1.18112 WP_001301452.1.18136 WP_001301452.1.18326 WP_001301452.1.1834 WP_001301452.1.18340 WP_001301452.1.1881 WP_001301452.1.18837 WP_001301452.1.18995 WP_001301452.1.19039 WP_001301452.1.191 WP_001301452.1.19140 WP_001301452.1.19350 WP_001301452.1.19419 WP_001301452.1.19661 WP_001301452.1.19840 WP_001301452.1.19847 WP_001301452.1.2005 WP_001301452.1.20449 WP_001301452.1.20480 WP_001301452.1.20546 WP_001301452.1.20594 WP_001301452.1.20745 WP_001301452.1.20893 WP_001301452.1.20941 WP_001301452.1.20950 WP_001301452.1.20989 WP_001301452.1.21508 WP_001301452.1.21666 WP_001301452.1.21668 WP_001301452.1.21756 WP_001301452.1.21962 WP_001301452.1.2218 WP_001301452.1.22251 WP_001301452.1.22304 WP_001301452.1.22381 WP_001301452.1.22594 WP_001301452.1.22743 WP_001301452.1.22925 WP_001301452.1.23073 WP_001301452.1.23115 WP_001301452.1.23241 WP_001301452.1.23323 WP_001301452.1.23355 WP_001301452.1.23467 WP_001301452.1.23790 WP_001301452.1.23806 WP_001301452.1.23838 WP_001301452.1.2388 WP_001301452.1.23895 WP_001301452.1.23899 WP_001301452.1.23973 WP_001301452.1.23984 WP_001301452.1.24070 WP_001301452.1.24283 WP_001301452.1.24341 WP_001301452.1.24634 WP_001301452.1.24753 WP_001301452.1.24870 WP_001301452.1.25076 WP_001301452.1.25082 WP_001301452.1.25088 WP_001301452.1.25201 WP_001301452.1.25305 WP_001301452.1.25526 WP_001301452.1.25577 WP_001301452.1.25794 WP_001301452.1.25819 WP_001301452.1.25831 WP_001301452.1.26066 WP_001301452.1.26105 WP_001301452.1.26121 WP_001301452.1.26134 WP_001301452.1.26246 WP_001301452.1.26474 WP_001301452.1.26525 WP_001301452.1.26590 WP_001301452.1.26761 WP_001301452.1.26878 WP_001301452.1.26975 WP_001301452.1.26998 WP_001301452.1.27338 WP_001301452.1.27445 WP_001301452.1.28143 WP_001301452.1.28551 WP_001301452.1.28734 WP_001301452.1.28879 WP_001301452.1.291 WP_001301452.1.29126 WP_001301452.1.29404 WP_001301452.1.29429 WP_001301452.1.29564 WP_001301452.1.29597 WP_001301452.1.29618 WP_001301452.1.2978 WP_001301452.1.29818 WP_001301452.1.29976 WP_001301452.1.30 WP_001301452.1.30019 WP_001301452.1.30052 WP_001301452.1.30064 WP_001301452.1.30164 WP_001301452.1.30476 WP_001301452.1.30637 WP_001301452.1.30918 WP_001301452.1.30993 WP_001301452.1.30999 WP_001301452.1.31055 WP_001301452.1.312 WP_001301452.1.31252 WP_001301452.1.3140 WP_001301452.1.31401 WP_001301452.1.31575 WP_001301452.1.31715 WP_001301452.1.31956 WP_001301452.1.32063 WP_001301452.1.322 WP_001301452.1.32222 WP_001301452.1.32243 WP_001301452.1.32536 WP_001301452.1.32574 WP_001301452.1.32590 WP_001301452.1.32888 WP_001301452.1.32931 WP_001301452.1.3295 WP_001301452.1.33049 WP_001301452.1.33055 WP_001301452.1.33094 WP_001301452.1.33125 WP_001301452.1.33146 WP_001301452.1.33167 WP_001301452.1.33178 WP_001301452.1.33268 WP_001301452.1.33476 WP_001301452.1.33981 WP_001301452.1.34224 WP_001301452.1.34269 WP_001301452.1.34383 WP_001301452.1.34500 WP_001301452.1.34680 WP_001301452.1.34686 WP_001301452.1.3515 WP_001301452.1.35393 WP_001301452.1.3550 WP_001301452.1.36010 WP_001301452.1.36212 WP_001301452.1.36626 WP_001301452.1.36767 WP_001301452.1.37102 WP_001301452.1.37337 WP_001301452.1.37372 WP_001301452.1.37472 WP_001301452.1.3762 WP_001301452.1.37731 WP_001301452.1.37766 WP_001301452.1.37769 WP_001301452.1.3795 WP_001301452.1.38050 WP_001301452.1.38063 WP_001301452.1.38107 WP_001301452.1.38306 WP_001301452.1.38369 WP_001301452.1.38835 WP_001301452.1.389 WP_001301452.1.38958 WP_001301452.1.39180 WP_001301452.1.39268 WP_001301452.1.39310 WP_001301452.1.39415 WP_001301452.1.39564 WP_001301452.1.39601 WP_001301452.1.39646 WP_001301452.1.39820 WP_001301452.1.40113 WP_001301452.1.40234 WP_001301452.1.40298 WP_001301452.1.4030 WP_001301452.1.40549 WP_001301452.1.40629 WP_001301452.1.40742 WP_001301452.1.40758 WP_001301452.1.40793 WP_001301452.1.40882 WP_001301452.1.40900 WP_001301452.1.40952 WP_001301452.1.4103 WP_001301452.1.41060 WP_001301452.1.41294 WP_001301452.1.41330 WP_001301452.1.41478 WP_001301452.1.41536 WP_001301452.1.41734 WP_001301452.1.41849 WP_001301452.1.42036 WP_001301452.1.4213 WP_001301452.1.42447 WP_001301452.1.4250 WP_001301452.1.42513 WP_001301452.1.42594 WP_001301452.1.4261 WP_001301452.1.42771 WP_001301452.1.42863 WP_001301452.1.42975 WP_001301452.1.43013 WP_001301452.1.43079 WP_001301452.1.43121 WP_001301452.1.4313 WP_001301452.1.43140 WP_001301452.1.43196 WP_001301452.1.43384 WP_001301452.1.43448 WP_001301452.1.43469 WP_001301452.1.43536 WP_001301452.1.43604 WP_001301452.1.43754 WP_001301452.1.43798 WP_001301452.1.43816 WP_001301452.1.43837 WP_001301452.1.43911 WP_001301452.1.43939 WP_001301452.1.44125 WP_001301452.1.44165 WP_001301452.1.44203 WP_001301452.1.44389 WP_001301452.1.44488 WP_001301452.1.44561 WP_001301452.1.44733 WP_001301452.1.44906 WP_001301452.1.44954 WP_001301452.1.45020 WP_001301452.1.45076 WP_001301452.1.45153 WP_001301452.1.45195 WP_001301452.1.45293 WP_001301452.1.45404 WP_001301452.1.45565 WP_001301452.1.45575 WP_001301452.1.45707 WP_001301452.1.45841 WP_001301452.1.45901 WP_001301452.1.45941 WP_001301452.1.46039 WP_001301452.1.4619 WP_001301452.1.46282 WP_001301452.1.46283 WP_001301452.1.46369 WP_001301452.1.46414 WP_001301452.1.46451 WP_001301452.1.4647 WP_001301452.1.46503 WP_001301452.1.46597 WP_001301452.1.46611 WP_001301452.1.46626 WP_001301452.1.46810 WP_001301452.1.46832 WP_001301452.1.46913 WP_001301452.1.4708 WP_001301452.1.47140 WP_001301452.1.4723 WP_001301452.1.47411 WP_001301452.1.47784 WP_001301452.1.47827 WP_001301452.1.47884 WP_001301452.1.47954 WP_001301452.1.47994 WP_001301452.1.48065 WP_001301452.1.4812 WP_001301452.1.48176 WP_001301452.1.48226 WP_001301452.1.48258 WP_001301452.1.48697 WP_001301452.1.48712 WP_001301452.1.48792 WP_001301452.1.48806 WP_001301452.1.48910 WP_001301452.1.4931 WP_001301452.1.49332 WP_001301452.1.49401 WP_001301452.1.49464 WP_001301452.1.49496 WP_001301452.1.49567 WP_001301452.1.49655 WP_001301452.1.49771 WP_001301452.1.5003 WP_001301452.1.50110 WP_001301452.1.50278 WP_001301452.1.50345 WP_001301452.1.50358 WP_001301452.1.5037 WP_001301452.1.50380 WP_001301452.1.50549 WP_001301452.1.50762 WP_001301452.1.50986 WP_001301452.1.51027 WP_001301452.1.51154 WP_001301452.1.51171 WP_001301452.1.51505 WP_001301452.1.51643 WP_001301452.1.51693 WP_001301452.1.51834 WP_001301452.1.52039 WP_001301452.1.5217 WP_001301452.1.52333 WP_001301452.1.52496 WP_001301452.1.52543 WP_001301452.1.52883 WP_001301452.1.52933 WP_001301452.1.53084 WP_001301452.1.53181 WP_001301452.1.53211 WP_001301452.1.53252 WP_001301452.1.53270 WP_001301452.1.54024 WP_001301452.1.54213 WP_001301452.1.5441 WP_001301452.1.54454 WP_001301452.1.5467 WP_001301452.1.54883 WP_001301452.1.55218 WP_001301452.1.55286 WP_001301452.1.55359 WP_001301452.1.55492 WP_001301452.1.55820 WP_001301452.1.55838 WP_001301452.1.55892 WP_001301452.1.55897 WP_001301452.1.56072 WP_001301452.1.56151 WP_001301452.1.5639 WP_001301452.1.56392 WP_001301452.1.56481 WP_001301452.1.56489 WP_001301452.1.56491 WP_001301452.1.56554 WP_001301452.1.56571 WP_001301452.1.57032 WP_001301452.1.57068 WP_001301452.1.57071 WP_001301452.1.57180 WP_001301452.1.57197 WP_001301452.1.57280 WP_001301452.1.57453 WP_001301452.1.57466 WP_001301452.1.57610 WP_001301452.1.5764 WP_001301452.1.57646 WP_001301452.1.57836 WP_001301452.1.58048 WP_001301452.1.58057 WP_001301452.1.58169 WP_001301452.1.58238 WP_001301452.1.584 WP_001301452.1.58423 WP_001301452.1.5852 WP_001301452.1.58707 WP_001301452.1.58723 WP_001301452.1.59038 WP_001301452.1.59359 WP_001301452.1.59374 WP_001301452.1.59470 WP_001301452.1.59491 WP_001301452.1.59679 WP_001301452.1.59733 WP_001301452.1.59838 WP_001301452.1.59905 WP_001301452.1.59931 WP_001301452.1.59959 WP_001301452.1.60042 WP_001301452.1.60043 WP_001301452.1.60117 WP_001301452.1.6013 WP_001301452.1.60304 WP_001301452.1.60374 WP_001301452.1.60461 WP_001301452.1.60613 WP_001301452.1.60647 WP_001301452.1.60744 WP_001301452.1.60761 WP_001301452.1.60872 WP_001301452.1.61039 WP_001301452.1.61099 WP_001301452.1.61108 WP_001301452.1.61186 WP_001301452.1.61253 WP_001301452.1.61623 WP_001301452.1.61772 WP_001301452.1.618 WP_001301452.1.61874 WP_001301452.1.62135 WP_001301452.1.62157 WP_001301452.1.62182 WP_001301452.1.62207 WP_001301452.1.62480 WP_001301452.1.62503 WP_001301452.1.6261 WP_001301452.1.62675 WP_001301452.1.62843 WP_001301452.1.62888 WP_001301452.1.6331 WP_001301452.1.63445 WP_001301452.1.6348 WP_001301452.1.63563 WP_001301452.1.63586 WP_001301452.1.63615 WP_001301452.1.6364 WP_001301452.1.63810 WP_001301452.1.63872 WP_001301452.1.63957 WP_001301452.1.64086 WP_001301452.1.64161 WP_001301452.1.64371 WP_001301452.1.6445 WP_001301452.1.64621 WP_001301452.1.64946 WP_001301452.1.65035 WP_001301452.1.65084 WP_001301452.1.6511 WP_001301452.1.65118 WP_001301452.1.65194 WP_001301452.1.65372 WP_001301452.1.65546 WP_001301452.1.6563 WP_001301452.1.6587 WP_001301452.1.65875 WP_001301452.1.65898 WP_001301452.1.65963 WP_001301452.1.65978 WP_001301452.1.65988 WP_001301452.1.66033 WP_001301452.1.66100 WP_001301452.1.66531 WP_001301452.1.66566 WP_001301452.1.66873 WP_001301452.1.66922 WP_001301452.1.67073 WP_001301452.1.67136 WP_001301452.1.67150 WP_001301452.1.67210 WP_001301452.1.67214 WP_001301452.1.67446 WP_001301452.1.67533 WP_001301452.1.67676 WP_001301452.1.6769 WP_001301452.1.67726 WP_001301452.1.67753 WP_001301452.1.67775 WP_001301452.1.67780 WP_001301452.1.68096 WP_001301452.1.68411 WP_001301452.1.68493 WP_001301452.1.68523 WP_001301452.1.6880 WP_001301452.1.6887 WP_001301452.1.68936 WP_001301452.1.69054 WP_001301452.1.69350 WP_001301452.1.69351 WP_001301452.1.69655 WP_001301452.1.69780 WP_001301452.1.69810 WP_001301452.1.69818 WP_001301452.1.69896 WP_001301452.1.70123 WP_001301452.1.70125 WP_001301452.1.70517 WP_001301452.1.70539 WP_001301452.1.70576 WP_001301452.1.70713 WP_001301452.1.70723 WP_001301452.1.70787 WP_001301452.1.71003 WP_001301452.1.71099 WP_001301452.1.71205 WP_001301452.1.71225 WP_001301452.1.71226 WP_001301452.1.71269 WP_001301452.1.71423 WP_001301452.1.71448 WP_001301452.1.71840 WP_001301452.1.71940 WP_001301452.1.72016 WP_001301452.1.72180 WP_001301452.1.72322 WP_001301452.1.72427 WP_001301452.1.72614 WP_001301452.1.72641 WP_001301452.1.72694 WP_001301452.1.7291 WP_001301452.1.72913 WP_001301452.1.73126 WP_001301452.1.73243 WP_001301452.1.73343 WP_001301452.1.73626 WP_001301452.1.73785 WP_001301452.1.73801 WP_001301452.1.7392 WP_001301452.1.73934 WP_001301452.1.73968 WP_001301452.1.74251 WP_001301452.1.7429 WP_001301452.1.7446 WP_001301452.1.74521 WP_001301452.1.74536 WP_001301452.1.74557 WP_001301452.1.74828 WP_001301452.1.74904 WP_001301452.1.75030 WP_001301452.1.75164 WP_001301452.1.7536 WP_001301452.1.75382 WP_001301452.1.7539 WP_001301452.1.75507 WP_001301452.1.75536 WP_001301452.1.75577 WP_001301452.1.75694 WP_001301452.1.75767 WP_001301452.1.7583 WP_001301452.1.75989 WP_001301452.1.76054 WP_001301452.1.7608 WP_001301452.1.76152 WP_001301452.1.76189 WP_001301452.1.76407 WP_001301452.1.76448 WP_001301452.1.76477 WP_001301452.1.76697 WP_001301452.1.76827 WP_001301452.1.77099 WP_001301452.1.77128 WP_001301452.1.77173 WP_001301452.1.77239 WP_001301452.1.77275 WP_001301452.1.77326 WP_001301452.1.77392 WP_001301452.1.77644 WP_001301452.1.77707 WP_001301452.1.77760 WP_001301452.1.77961 WP_001301452.1.77979 WP_001301452.1.7799 WP_001301452.1.78063 WP_001301452.1.78101 WP_001301452.1.784 WP_001301452.1.7855 WP_001301452.1.78593 WP_001301452.1.78611 WP_001301452.1.79172 WP_001301452.1.7940 WP_001301452.1.79528 WP_001301452.1.79563 WP_001301452.1.79576 WP_001301452.1.79715 WP_001301452.1.79965 WP_001301452.1.80309 WP_001301452.1.80330 WP_001301452.1.80519 WP_001301452.1.80578 WP_001301452.1.80606 WP_001301452.1.81070 WP_001301452.1.81160 WP_001301452.1.81273 WP_001301452.1.81420 WP_001301452.1.81442 WP_001301452.1.81514 WP_001301452.1.81754 WP_001301452.1.81821 WP_001301452.1.81873 WP_001301452.1.81934 WP_001301452.1.81975 WP_001301452.1.82010 WP_001301452.1.82057 WP_001301452.1.82296 WP_001301452.1.82594 WP_001301452.1.82629 WP_001301452.1.82661 WP_001301452.1.8268 WP_001301452.1.82797 WP_001301452.1.82820 WP_001301452.1.83099 WP_001301452.1.83712 WP_001301452.1.84219 WP_001301452.1.84264 WP_001301452.1.84312 WP_001301452.1.84482 WP_001301452.1.84635 WP_001301452.1.84657 WP_001301452.1.8477 WP_001301452.1.84948 WP_001301452.1.84966 WP_001301452.1.85253 WP_001301452.1.85558 WP_001301452.1.85722 WP_001301452.1.85772 WP_001301452.1.86105 WP_001301452.1.86171 WP_001301452.1.86225 WP_001301452.1.86255 WP_001301452.1.86340 WP_001301452.1.86574 WP_001301452.1.86994 WP_001301452.1.87076 WP_001301452.1.87247 WP_001301452.1.87254 WP_001301452.1.87382 WP_001301452.1.87616 WP_001301452.1.88197 WP_001301452.1.88263 WP_001301452.1.8843 WP_001301452.1.88524 WP_001301452.1.88528 WP_001301452.1.88803 WP_001301452.1.88891 WP_001301452.1.89322 WP_001301452.1.89385 WP_001301452.1.89405 WP_001301452.1.89569 WP_001301452.1.89781 WP_001301452.1.89852 WP_001301452.1.89959 WP_001301452.1.89988 WP_001301452.1.90139 WP_001301452.1.90219 WP_001301452.1.90257 WP_001301452.1.90342 WP_001301452.1.90349 WP_001301452.1.90449 WP_001301452.1.90837 WP_001301452.1.90848 WP_001301452.1.90967 WP_001301452.1.9098 WP_001301452.1.90997 WP_001301452.1.91072 WP_001301452.1.91088 WP_001301452.1.91153 WP_001301452.1.91288 WP_001301452.1.91356 WP_001301452.1.91384 WP_001301452.1.91516 WP_001301452.1.91548 WP_001301452.1.91651 WP_001301452.1.9168 WP_001301452.1.91801 WP_001301452.1.91871 WP_001301452.1.92819 WP_001301452.1.93027 WP_001301452.1.93069 WP_001301452.1.93427 WP_001301452.1.93428 WP_001301452.1.93601 WP_001301452.1.93630 WP_001301452.1.93670 WP_001301452.1.93695 WP_001301452.1.93821 WP_001301452.1.94213 WP_001301452.1.9426 WP_001301452.1.94302 WP_001301452.1.94343 WP_001301452.1.94544 WP_001301452.1.94589 WP_001301452.1.94676 WP_001301452.1.94790 WP_001301452.1.94991 WP_001301452.1.95011 WP_001301452.1.95028 WP_001301452.1.95035 WP_001301452.1.95129 WP_001301452.1.95834 WP_001301452.1.9616 WP_001301452.1.96425 WP_001301452.1.96450 WP_001301452.1.96480 WP_001301452.1.96725 WP_001301452.1.96796 WP_001301452.1.97193 WP_001301452.1.9729 WP_001301452.1.9740 WP_001301452.1.97402 WP_001301452.1.97513 WP_001301452.1.97619 WP_001301452.1.97632 WP_001301452.1.9770 WP_001301452.1.97789 WP_001301452.1.97871 WP_001301452.1.98046 WP_001301452.1.98083 WP_001301452.1.981 WP_001301452.1.98155 WP_001301452.1.98176 WP_001301452.1.98187 WP_001301452.1.98205 WP_001301452.1.98279 WP_001301452.1.98312 WP_001301452.1.98384 WP_001301452.1.98543 WP_001301452.1.98569 WP_001301452.1.9883 WP_001301452.1.98920 WP_001301452.1.99101 WP_001301452.1.99182 WP_001301452.1.99234 WP_001301452.1.99487 WP_001301452.1.99501 WP_001301452.1.99692 WP_001301452.1.99986 gi|15803926|ref|NP_289962.1| gi|387508788|ref|YP_006161044.1| gi|254795336|ref|YP_003080173.1| gi|15833516|ref|NP_312289.1| Z4777_ECO57

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]