SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15833561|ref|NP_312334.1| from Escherichia coli O157:H7 str. Sakai

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15833561|ref|NP_312334.1|
Domain Number 1 Region: 41-151
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000023
Family N-acetyl transferase, NAT 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15833561|ref|NP_312334.1|
Sequence length 175
Comment hypothetical protein ECs4307 [Escherichia coli O157:H7 str. Sakai]
Sequence
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLG
YYTLCGSCFERAALPSKSKQKKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVW
SASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENALFFPTKSIELLFTQSD
Download sequence
Identical sequences A0A0F6CA44 A0A0F6FDG3 A0A0H3JPT2 A0A0H3PTP6 A0A0K4I8K2 A0A1Z3UYK2 A0A2H1BD78 D3QU63 T9TB25
gi|209399042|ref|YP_002272902.1| gi|387884608|ref|YP_006314910.1| 386585.ECs4307 444450.ECH74115_4777 544404.ECSP_4414 gi|291284798|ref|YP_003501616.1| gi|254795378|ref|YP_003080215.1| gi|15833561|ref|NP_312334.1| gi|387508830|ref|YP_006161086.1| NP_312334.1.58667 WP_000342448.1.10001 WP_000342448.1.100073 WP_000342448.1.10010 WP_000342448.1.100299 WP_000342448.1.100302 WP_000342448.1.100508 WP_000342448.1.100554 WP_000342448.1.100925 WP_000342448.1.101105 WP_000342448.1.101166 WP_000342448.1.101206 WP_000342448.1.101628 WP_000342448.1.101977 WP_000342448.1.10206 WP_000342448.1.102094 WP_000342448.1.102139 WP_000342448.1.10273 WP_000342448.1.10335 WP_000342448.1.10476 WP_000342448.1.10761 WP_000342448.1.10970 WP_000342448.1.1111 WP_000342448.1.11240 WP_000342448.1.11301 WP_000342448.1.11420 WP_000342448.1.11671 WP_000342448.1.11690 WP_000342448.1.12259 WP_000342448.1.12305 WP_000342448.1.12552 WP_000342448.1.13060 WP_000342448.1.13217 WP_000342448.1.13223 WP_000342448.1.13332 WP_000342448.1.13348 WP_000342448.1.13430 WP_000342448.1.13442 WP_000342448.1.13481 WP_000342448.1.13881 WP_000342448.1.13936 WP_000342448.1.13939 WP_000342448.1.14110 WP_000342448.1.14453 WP_000342448.1.14621 WP_000342448.1.14748 WP_000342448.1.15356 WP_000342448.1.15503 WP_000342448.1.15527 WP_000342448.1.1559 WP_000342448.1.15626 WP_000342448.1.15702 WP_000342448.1.15782 WP_000342448.1.16075 WP_000342448.1.16222 WP_000342448.1.16272 WP_000342448.1.16463 WP_000342448.1.16481 WP_000342448.1.16845 WP_000342448.1.17187 WP_000342448.1.1731 WP_000342448.1.17386 WP_000342448.1.17415 WP_000342448.1.17515 WP_000342448.1.17904 WP_000342448.1.18136 WP_000342448.1.18326 WP_000342448.1.1834 WP_000342448.1.18340 WP_000342448.1.1881 WP_000342448.1.18837 WP_000342448.1.18995 WP_000342448.1.19039 WP_000342448.1.191 WP_000342448.1.19140 WP_000342448.1.19350 WP_000342448.1.19419 WP_000342448.1.19840 WP_000342448.1.19847 WP_000342448.1.2005 WP_000342448.1.20264 WP_000342448.1.20449 WP_000342448.1.20480 WP_000342448.1.20546 WP_000342448.1.20594 WP_000342448.1.20745 WP_000342448.1.20893 WP_000342448.1.20941 WP_000342448.1.20950 WP_000342448.1.20989 WP_000342448.1.21508 WP_000342448.1.21666 WP_000342448.1.21668 WP_000342448.1.21962 WP_000342448.1.2218 WP_000342448.1.22251 WP_000342448.1.22304 WP_000342448.1.22381 WP_000342448.1.22594 WP_000342448.1.22925 WP_000342448.1.23073 WP_000342448.1.23115 WP_000342448.1.23241 WP_000342448.1.23323 WP_000342448.1.23355 WP_000342448.1.23467 WP_000342448.1.23790 WP_000342448.1.23806 WP_000342448.1.23838 WP_000342448.1.2388 WP_000342448.1.23895 WP_000342448.1.23899 WP_000342448.1.23973 WP_000342448.1.23984 WP_000342448.1.24070 WP_000342448.1.24283 WP_000342448.1.24341 WP_000342448.1.24753 WP_000342448.1.24854 WP_000342448.1.24870 WP_000342448.1.25076 WP_000342448.1.25082 WP_000342448.1.25088 WP_000342448.1.25201 WP_000342448.1.25305 WP_000342448.1.25526 WP_000342448.1.25577 WP_000342448.1.25794 WP_000342448.1.25819 WP_000342448.1.25831 WP_000342448.1.26066 WP_000342448.1.26105 WP_000342448.1.26121 WP_000342448.1.26134 WP_000342448.1.26246 WP_000342448.1.26474 WP_000342448.1.26525 WP_000342448.1.26590 WP_000342448.1.26761 WP_000342448.1.26878 WP_000342448.1.26975 WP_000342448.1.26998 WP_000342448.1.27338 WP_000342448.1.27445 WP_000342448.1.28143 WP_000342448.1.28551 WP_000342448.1.28734 WP_000342448.1.28863 WP_000342448.1.28879 WP_000342448.1.291 WP_000342448.1.29126 WP_000342448.1.29404 WP_000342448.1.29564 WP_000342448.1.29597 WP_000342448.1.29618 WP_000342448.1.2978 WP_000342448.1.29818 WP_000342448.1.29976 WP_000342448.1.30 WP_000342448.1.30019 WP_000342448.1.30052 WP_000342448.1.30064 WP_000342448.1.30164 WP_000342448.1.30476 WP_000342448.1.30637 WP_000342448.1.30918 WP_000342448.1.31055 WP_000342448.1.31154 WP_000342448.1.312 WP_000342448.1.31252 WP_000342448.1.3140 WP_000342448.1.31401 WP_000342448.1.31575 WP_000342448.1.31715 WP_000342448.1.31956 WP_000342448.1.32063 WP_000342448.1.322 WP_000342448.1.32243 WP_000342448.1.32536 WP_000342448.1.32574 WP_000342448.1.32590 WP_000342448.1.32888 WP_000342448.1.32931 WP_000342448.1.3295 WP_000342448.1.33049 WP_000342448.1.33055 WP_000342448.1.33125 WP_000342448.1.33146 WP_000342448.1.33167 WP_000342448.1.33178 WP_000342448.1.33268 WP_000342448.1.33981 WP_000342448.1.34224 WP_000342448.1.34269 WP_000342448.1.34383 WP_000342448.1.34500 WP_000342448.1.34680 WP_000342448.1.34686 WP_000342448.1.35393 WP_000342448.1.3550 WP_000342448.1.36010 WP_000342448.1.36212 WP_000342448.1.36626 WP_000342448.1.36767 WP_000342448.1.37102 WP_000342448.1.37337 WP_000342448.1.37372 WP_000342448.1.3762 WP_000342448.1.37731 WP_000342448.1.37766 WP_000342448.1.37769 WP_000342448.1.3795 WP_000342448.1.38050 WP_000342448.1.38063 WP_000342448.1.38107 WP_000342448.1.38306 WP_000342448.1.38369 WP_000342448.1.38835 WP_000342448.1.389 WP_000342448.1.38958 WP_000342448.1.39180 WP_000342448.1.39268 WP_000342448.1.39310 WP_000342448.1.39415 WP_000342448.1.39564 WP_000342448.1.39601 WP_000342448.1.39646 WP_000342448.1.39820 WP_000342448.1.40113 WP_000342448.1.40234 WP_000342448.1.4030 WP_000342448.1.40549 WP_000342448.1.40629 WP_000342448.1.40742 WP_000342448.1.40758 WP_000342448.1.40793 WP_000342448.1.40882 WP_000342448.1.40900 WP_000342448.1.4103 WP_000342448.1.41060 WP_000342448.1.41294 WP_000342448.1.41330 WP_000342448.1.41401 WP_000342448.1.41478 WP_000342448.1.41536 WP_000342448.1.41734 WP_000342448.1.41849 WP_000342448.1.42036 WP_000342448.1.4213 WP_000342448.1.42447 WP_000342448.1.4250 WP_000342448.1.42513 WP_000342448.1.42594 WP_000342448.1.4261 WP_000342448.1.42863 WP_000342448.1.42975 WP_000342448.1.43013 WP_000342448.1.43079 WP_000342448.1.43121 WP_000342448.1.4313 WP_000342448.1.43140 WP_000342448.1.43196 WP_000342448.1.43384 WP_000342448.1.43448 WP_000342448.1.43469 WP_000342448.1.43536 WP_000342448.1.43604 WP_000342448.1.43754 WP_000342448.1.43798 WP_000342448.1.43816 WP_000342448.1.43837 WP_000342448.1.43911 WP_000342448.1.44125 WP_000342448.1.44165 WP_000342448.1.44203 WP_000342448.1.44389 WP_000342448.1.44488 WP_000342448.1.44561 WP_000342448.1.44733 WP_000342448.1.44906 WP_000342448.1.44954 WP_000342448.1.45020 WP_000342448.1.45076 WP_000342448.1.45153 WP_000342448.1.45195 WP_000342448.1.45293 WP_000342448.1.45404 WP_000342448.1.45575 WP_000342448.1.45707 WP_000342448.1.45841 WP_000342448.1.45901 WP_000342448.1.45941 WP_000342448.1.46039 WP_000342448.1.4619 WP_000342448.1.46282 WP_000342448.1.46283 WP_000342448.1.46414 WP_000342448.1.46451 WP_000342448.1.46503 WP_000342448.1.46597 WP_000342448.1.46611 WP_000342448.1.46626 WP_000342448.1.46810 WP_000342448.1.46832 WP_000342448.1.46913 WP_000342448.1.4708 WP_000342448.1.47140 WP_000342448.1.4723 WP_000342448.1.47411 WP_000342448.1.47784 WP_000342448.1.47827 WP_000342448.1.47884 WP_000342448.1.47954 WP_000342448.1.47994 WP_000342448.1.48065 WP_000342448.1.4812 WP_000342448.1.48176 WP_000342448.1.48226 WP_000342448.1.48258 WP_000342448.1.48697 WP_000342448.1.48712 WP_000342448.1.48792 WP_000342448.1.48806 WP_000342448.1.4931 WP_000342448.1.49332 WP_000342448.1.49401 WP_000342448.1.49464 WP_000342448.1.49496 WP_000342448.1.49567 WP_000342448.1.49655 WP_000342448.1.49771 WP_000342448.1.5003 WP_000342448.1.50110 WP_000342448.1.50358 WP_000342448.1.5037 WP_000342448.1.50380 WP_000342448.1.50549 WP_000342448.1.50762 WP_000342448.1.50986 WP_000342448.1.51154 WP_000342448.1.51171 WP_000342448.1.51505 WP_000342448.1.51643 WP_000342448.1.51693 WP_000342448.1.52039 WP_000342448.1.5217 WP_000342448.1.52496 WP_000342448.1.52543 WP_000342448.1.52883 WP_000342448.1.52933 WP_000342448.1.53084 WP_000342448.1.53181 WP_000342448.1.53211 WP_000342448.1.53252 WP_000342448.1.53270 WP_000342448.1.54024 WP_000342448.1.54213 WP_000342448.1.5441 WP_000342448.1.54454 WP_000342448.1.5467 WP_000342448.1.5486 WP_000342448.1.54883 WP_000342448.1.55218 WP_000342448.1.55286 WP_000342448.1.55492 WP_000342448.1.55820 WP_000342448.1.55838 WP_000342448.1.55892 WP_000342448.1.55897 WP_000342448.1.56072 WP_000342448.1.56151 WP_000342448.1.5639 WP_000342448.1.56392 WP_000342448.1.56481 WP_000342448.1.56489 WP_000342448.1.56491 WP_000342448.1.56501 WP_000342448.1.56554 WP_000342448.1.56571 WP_000342448.1.57032 WP_000342448.1.57071 WP_000342448.1.57180 WP_000342448.1.57197 WP_000342448.1.57280 WP_000342448.1.57453 WP_000342448.1.57466 WP_000342448.1.57517 WP_000342448.1.57610 WP_000342448.1.5764 WP_000342448.1.57646 WP_000342448.1.57836 WP_000342448.1.58048 WP_000342448.1.58057 WP_000342448.1.58169 WP_000342448.1.58238 WP_000342448.1.584 WP_000342448.1.58423 WP_000342448.1.5852 WP_000342448.1.58707 WP_000342448.1.58723 WP_000342448.1.59038 WP_000342448.1.59359 WP_000342448.1.59374 WP_000342448.1.59470 WP_000342448.1.59491 WP_000342448.1.59679 WP_000342448.1.59733 WP_000342448.1.59838 WP_000342448.1.59905 WP_000342448.1.59931 WP_000342448.1.59959 WP_000342448.1.60042 WP_000342448.1.60043 WP_000342448.1.60117 WP_000342448.1.6013 WP_000342448.1.60304 WP_000342448.1.60374 WP_000342448.1.60461 WP_000342448.1.60613 WP_000342448.1.60647 WP_000342448.1.60744 WP_000342448.1.60761 WP_000342448.1.60872 WP_000342448.1.60935 WP_000342448.1.61039 WP_000342448.1.61099 WP_000342448.1.61108 WP_000342448.1.61186 WP_000342448.1.61253 WP_000342448.1.61623 WP_000342448.1.61772 WP_000342448.1.618 WP_000342448.1.61874 WP_000342448.1.62135 WP_000342448.1.62182 WP_000342448.1.62480 WP_000342448.1.6261 WP_000342448.1.62675 WP_000342448.1.62843 WP_000342448.1.62888 WP_000342448.1.6331 WP_000342448.1.63445 WP_000342448.1.63563 WP_000342448.1.63586 WP_000342448.1.63615 WP_000342448.1.6364 WP_000342448.1.63872 WP_000342448.1.63957 WP_000342448.1.64086 WP_000342448.1.64161 WP_000342448.1.64371 WP_000342448.1.6445 WP_000342448.1.64621 WP_000342448.1.64946 WP_000342448.1.65035 WP_000342448.1.65084 WP_000342448.1.6511 WP_000342448.1.65194 WP_000342448.1.65372 WP_000342448.1.65546 WP_000342448.1.6587 WP_000342448.1.65875 WP_000342448.1.65898 WP_000342448.1.65963 WP_000342448.1.65978 WP_000342448.1.65988 WP_000342448.1.66033 WP_000342448.1.66100 WP_000342448.1.66531 WP_000342448.1.66566 WP_000342448.1.66873 WP_000342448.1.66922 WP_000342448.1.67073 WP_000342448.1.67136 WP_000342448.1.67150 WP_000342448.1.67214 WP_000342448.1.67446 WP_000342448.1.67533 WP_000342448.1.6769 WP_000342448.1.67726 WP_000342448.1.67753 WP_000342448.1.67775 WP_000342448.1.67780 WP_000342448.1.68096 WP_000342448.1.68411 WP_000342448.1.68493 WP_000342448.1.68523 WP_000342448.1.6880 WP_000342448.1.6887 WP_000342448.1.68936 WP_000342448.1.69054 WP_000342448.1.69350 WP_000342448.1.69351 WP_000342448.1.69780 WP_000342448.1.69810 WP_000342448.1.69818 WP_000342448.1.69896 WP_000342448.1.70125 WP_000342448.1.70517 WP_000342448.1.70539 WP_000342448.1.70576 WP_000342448.1.70713 WP_000342448.1.70723 WP_000342448.1.70787 WP_000342448.1.71003 WP_000342448.1.71099 WP_000342448.1.71205 WP_000342448.1.71225 WP_000342448.1.71226 WP_000342448.1.71269 WP_000342448.1.71423 WP_000342448.1.71448 WP_000342448.1.71940 WP_000342448.1.72016 WP_000342448.1.72180 WP_000342448.1.72322 WP_000342448.1.72427 WP_000342448.1.72614 WP_000342448.1.72641 WP_000342448.1.72694 WP_000342448.1.7291 WP_000342448.1.72913 WP_000342448.1.73126 WP_000342448.1.73343 WP_000342448.1.73626 WP_000342448.1.73785 WP_000342448.1.73801 WP_000342448.1.7392 WP_000342448.1.73934 WP_000342448.1.73968 WP_000342448.1.74251 WP_000342448.1.7429 WP_000342448.1.7446 WP_000342448.1.74521 WP_000342448.1.74536 WP_000342448.1.74557 WP_000342448.1.74828 WP_000342448.1.74904 WP_000342448.1.75030 WP_000342448.1.75164 WP_000342448.1.75248 WP_000342448.1.7536 WP_000342448.1.75382 WP_000342448.1.7539 WP_000342448.1.75507 WP_000342448.1.75536 WP_000342448.1.75577 WP_000342448.1.75694 WP_000342448.1.75767 WP_000342448.1.7583 WP_000342448.1.75922 WP_000342448.1.75989 WP_000342448.1.76054 WP_000342448.1.7608 WP_000342448.1.76152 WP_000342448.1.76189 WP_000342448.1.76407 WP_000342448.1.76448 WP_000342448.1.76477 WP_000342448.1.76697 WP_000342448.1.76827 WP_000342448.1.77099 WP_000342448.1.77128 WP_000342448.1.77239 WP_000342448.1.77275 WP_000342448.1.77392 WP_000342448.1.77644 WP_000342448.1.77707 WP_000342448.1.77760 WP_000342448.1.77961 WP_000342448.1.77979 WP_000342448.1.7799 WP_000342448.1.78063 WP_000342448.1.784 WP_000342448.1.7855 WP_000342448.1.78611 WP_000342448.1.79172 WP_000342448.1.7940 WP_000342448.1.79528 WP_000342448.1.79563 WP_000342448.1.79576 WP_000342448.1.79715 WP_000342448.1.79965 WP_000342448.1.80309 WP_000342448.1.80330 WP_000342448.1.80606 WP_000342448.1.81070 WP_000342448.1.81160 WP_000342448.1.81273 WP_000342448.1.81420 WP_000342448.1.81442 WP_000342448.1.81514 WP_000342448.1.81754 WP_000342448.1.81821 WP_000342448.1.81873 WP_000342448.1.81934 WP_000342448.1.81975 WP_000342448.1.82010 WP_000342448.1.82057 WP_000342448.1.82296 WP_000342448.1.82594 WP_000342448.1.82629 WP_000342448.1.8268 WP_000342448.1.82797 WP_000342448.1.82820 WP_000342448.1.83099 WP_000342448.1.83706 WP_000342448.1.83712 WP_000342448.1.84219 WP_000342448.1.84312 WP_000342448.1.84482 WP_000342448.1.84635 WP_000342448.1.84657 WP_000342448.1.8477 WP_000342448.1.85253 WP_000342448.1.85558 WP_000342448.1.85722 WP_000342448.1.85772 WP_000342448.1.86105 WP_000342448.1.86171 WP_000342448.1.86225 WP_000342448.1.86255 WP_000342448.1.86340 WP_000342448.1.86574 WP_000342448.1.86994 WP_000342448.1.87076 WP_000342448.1.87247 WP_000342448.1.87254 WP_000342448.1.87382 WP_000342448.1.87616 WP_000342448.1.88197 WP_000342448.1.8843 WP_000342448.1.88524 WP_000342448.1.88803 WP_000342448.1.88891 WP_000342448.1.89322 WP_000342448.1.89385 WP_000342448.1.89405 WP_000342448.1.89569 WP_000342448.1.89781 WP_000342448.1.89852 WP_000342448.1.89988 WP_000342448.1.90139 WP_000342448.1.90219 WP_000342448.1.90257 WP_000342448.1.90342 WP_000342448.1.90349 WP_000342448.1.90837 WP_000342448.1.90848 WP_000342448.1.90967 WP_000342448.1.9098 WP_000342448.1.90997 WP_000342448.1.91072 WP_000342448.1.91088 WP_000342448.1.91153 WP_000342448.1.91288 WP_000342448.1.91356 WP_000342448.1.91384 WP_000342448.1.91548 WP_000342448.1.91651 WP_000342448.1.9168 WP_000342448.1.91801 WP_000342448.1.91871 WP_000342448.1.92005 WP_000342448.1.92819 WP_000342448.1.93027 WP_000342448.1.93069 WP_000342448.1.93427 WP_000342448.1.93428 WP_000342448.1.93601 WP_000342448.1.93630 WP_000342448.1.93670 WP_000342448.1.93695 WP_000342448.1.93821 WP_000342448.1.94213 WP_000342448.1.9426 WP_000342448.1.94302 WP_000342448.1.94343 WP_000342448.1.94544 WP_000342448.1.94589 WP_000342448.1.94676 WP_000342448.1.94790 WP_000342448.1.94991 WP_000342448.1.95011 WP_000342448.1.95028 WP_000342448.1.95035 WP_000342448.1.95129 WP_000342448.1.95834 WP_000342448.1.9616 WP_000342448.1.96425 WP_000342448.1.96450 WP_000342448.1.96480 WP_000342448.1.96725 WP_000342448.1.96796 WP_000342448.1.97193 WP_000342448.1.9729 WP_000342448.1.9740 WP_000342448.1.97402 WP_000342448.1.97513 WP_000342448.1.97632 WP_000342448.1.9770 WP_000342448.1.97789 WP_000342448.1.97871 WP_000342448.1.98046 WP_000342448.1.98083 WP_000342448.1.981 WP_000342448.1.98155 WP_000342448.1.98176 WP_000342448.1.98187 WP_000342448.1.98205 WP_000342448.1.98279 WP_000342448.1.98312 WP_000342448.1.98384 WP_000342448.1.98543 WP_000342448.1.98569 WP_000342448.1.9883 WP_000342448.1.98920 WP_000342448.1.99101 WP_000342448.1.99182 WP_000342448.1.99234 WP_000342448.1.99487 WP_000342448.1.99501 WP_000342448.1.99692 WP_000342448.1.99986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]