SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15834065|ref|NP_312838.1| from Escherichia coli O157:H7 str. Sakai

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15834065|ref|NP_312838.1|
Domain Number 1 Region: 171-313
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 8.25e-41
Family PaaI/YdiI-like 0.00013
Further Details:      
 
Domain Number 2 Region: 15-162
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.69e-29
Family N-acetyl transferase, NAT 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15834065|ref|NP_312838.1|
Sequence length 329
Comment acetyltransferase [Escherichia coli O157:H7 str. Sakai]
Sequence
MSQLPGLSRETRESIAMYHLRVPQTEEELERYYQFRWEMLRKPLHQPKGSERDAWDAMAH
HQMVVDEQGNLVAVGRLYINADNEASIRFMAVHPDVQDKGLGTLMAMTLESVARQEGVKR
VTCSAREDAVEFFAKLGFVNQGEITTPTTTPIRHFLMIKPVATLDDILHRGDWCAQLQQA
WYEHIPLSEKMGVRIQQYTGQKFITTMPETGNQNPHHTLFAGSLFSLATLTGWGLIWLML
RERHLGGTIILADAHIRYSKPISGKPHAVADLGALSGDLDRLARGRKARVQMQVEIFGDE
TPGAVFEGTYIVLPAKPFGPYEEGGNEEE
Download sequence
Identical sequences A0A0A0F6H0 A0A0E0U769 A0A0E0Y7A0 A0A0F6CBJ6 A0A0F6FEZ6 A0A0H2Z5P3 A0A0H3MK36 A0A0H3PYX9 A0A192CEU4 A0A1S6TJ33 A0A1X3HZL0 A0A1X3IEE6 A0A1X3IU12 A0A1X3J9M7 A0A1X3K253 A0A1X3KW29 A0A1Z3UX84 A0A235XMI0 A0A237G0S9 A0A2K0Q3I4 B7L9E1 B7LVG1 B7MI19 C3SJF7 C8UKE5 D3QY84 D7Y5G0 D7ZH42 D8A9U0 D8EAN1 E1IUE9 E3PB21 E9TAN2 E9XUR6 F3WQI6 F4SRU0 F4T6B4 F4V8J6 F4VLT0 I2UCM0 K4VRB3 K4WY91 P0ADQ2 P0ADQ3 P0ADQ4 Q1R430 Q31UA5 U9XP09 U9YKC9 V0SJJ6 V0YV89 V0ZNN8 V6G015 V8FML4 W1AL79 W8ZZR0
gi|218560958|ref|YP_002393871.1| gi|82546234|ref|YP_410181.1| NP_312838.1.58667 NP_418324.1.90541 WP_000080791.1.1000 WP_000080791.1.10001 WP_000080791.1.100014 WP_000080791.1.100066 WP_000080791.1.100073 WP_000080791.1.100085 WP_000080791.1.10010 WP_000080791.1.100111 WP_000080791.1.100116 WP_000080791.1.100138 WP_000080791.1.100151 WP_000080791.1.100159 WP_000080791.1.100185 WP_000080791.1.100227 WP_000080791.1.100251 WP_000080791.1.100281 WP_000080791.1.100299 WP_000080791.1.100302 WP_000080791.1.100304 WP_000080791.1.100306 WP_000080791.1.10034 WP_000080791.1.100425 WP_000080791.1.100441 WP_000080791.1.100447 WP_000080791.1.100451 WP_000080791.1.100474 WP_000080791.1.100487 WP_000080791.1.100499 WP_000080791.1.100508 WP_000080791.1.10051 WP_000080791.1.100531 WP_000080791.1.100543 WP_000080791.1.100554 WP_000080791.1.100573 WP_000080791.1.100614 WP_000080791.1.100667 WP_000080791.1.10067 WP_000080791.1.10068 WP_000080791.1.100689 WP_000080791.1.100718 WP_000080791.1.100735 WP_000080791.1.100738 WP_000080791.1.100752 WP_000080791.1.100753 WP_000080791.1.100758 WP_000080791.1.10080 WP_000080791.1.100824 WP_000080791.1.100836 WP_000080791.1.10086 WP_000080791.1.100867 WP_000080791.1.100868 WP_000080791.1.100898 WP_000080791.1.100916 WP_000080791.1.100925 WP_000080791.1.10094 WP_000080791.1.100950 WP_000080791.1.100959 WP_000080791.1.100966 WP_000080791.1.101033 WP_000080791.1.101052 WP_000080791.1.101087 WP_000080791.1.101096 WP_000080791.1.101102 WP_000080791.1.101105 WP_000080791.1.101110 WP_000080791.1.101148 WP_000080791.1.101152 WP_000080791.1.101157 WP_000080791.1.101158 WP_000080791.1.101166 WP_000080791.1.101186 WP_000080791.1.101206 WP_000080791.1.101255 WP_000080791.1.10126 WP_000080791.1.101282 WP_000080791.1.101289 WP_000080791.1.10131 WP_000080791.1.101359 WP_000080791.1.10138 WP_000080791.1.101387 WP_000080791.1.101399 WP_000080791.1.101418 WP_000080791.1.101423 WP_000080791.1.101430 WP_000080791.1.101436 WP_000080791.1.101439 WP_000080791.1.101445 WP_000080791.1.101468 WP_000080791.1.101518 WP_000080791.1.10154 WP_000080791.1.101583 WP_000080791.1.101586 WP_000080791.1.101628 WP_000080791.1.101630 WP_000080791.1.101651 WP_000080791.1.101653 WP_000080791.1.101654 WP_000080791.1.101668 WP_000080791.1.101686 WP_000080791.1.101693 WP_000080791.1.101694 WP_000080791.1.101700 WP_000080791.1.101727 WP_000080791.1.101737 WP_000080791.1.101747 WP_000080791.1.101769 WP_000080791.1.101786 WP_000080791.1.10181 WP_000080791.1.101822 WP_000080791.1.101840 WP_000080791.1.101845 WP_000080791.1.101855 WP_000080791.1.10187 WP_000080791.1.10188 WP_000080791.1.10190 WP_000080791.1.101913 WP_000080791.1.101926 WP_000080791.1.101932 WP_000080791.1.101947 WP_000080791.1.101948 WP_000080791.1.101952 WP_000080791.1.101962 WP_000080791.1.101969 WP_000080791.1.101984 WP_000080791.1.101987 WP_000080791.1.102036 WP_000080791.1.10206 WP_000080791.1.102069 WP_000080791.1.102076 WP_000080791.1.102104 WP_000080791.1.102106 WP_000080791.1.102122 WP_000080791.1.102139 WP_000080791.1.102144 WP_000080791.1.10233 WP_000080791.1.10235 WP_000080791.1.10252 WP_000080791.1.10273 WP_000080791.1.10326 WP_000080791.1.10335 WP_000080791.1.10381 WP_000080791.1.1040 WP_000080791.1.10400 WP_000080791.1.10417 WP_000080791.1.10461 WP_000080791.1.10476 WP_000080791.1.10491 WP_000080791.1.10492 WP_000080791.1.10496 WP_000080791.1.10538 WP_000080791.1.10569 WP_000080791.1.10573 WP_000080791.1.10579 WP_000080791.1.1058 WP_000080791.1.10607 WP_000080791.1.10651 WP_000080791.1.10673 WP_000080791.1.10697 WP_000080791.1.10705 WP_000080791.1.1071 WP_000080791.1.10729 WP_000080791.1.10744 WP_000080791.1.10748 WP_000080791.1.10761 WP_000080791.1.10763 WP_000080791.1.10786 WP_000080791.1.10787 WP_000080791.1.10798 WP_000080791.1.10814 WP_000080791.1.10833 WP_000080791.1.10842 WP_000080791.1.10849 WP_000080791.1.10869 WP_000080791.1.10922 WP_000080791.1.10940 WP_000080791.1.10970 WP_000080791.1.10994 WP_000080791.1.11032 WP_000080791.1.11047 WP_000080791.1.11057 WP_000080791.1.11068 WP_000080791.1.11071 WP_000080791.1.1111 WP_000080791.1.11113 WP_000080791.1.11118 WP_000080791.1.1113 WP_000080791.1.112 WP_000080791.1.11217 WP_000080791.1.1122 WP_000080791.1.11240 WP_000080791.1.11241 WP_000080791.1.11250 WP_000080791.1.11265 WP_000080791.1.11285 WP_000080791.1.11296 WP_000080791.1.11301 WP_000080791.1.11315 WP_000080791.1.11408 WP_000080791.1.11411 WP_000080791.1.11418 WP_000080791.1.11420 WP_000080791.1.11437 WP_000080791.1.11467 WP_000080791.1.11519 WP_000080791.1.11524 WP_000080791.1.11531 WP_000080791.1.11575 WP_000080791.1.11578 WP_000080791.1.11607 WP_000080791.1.11608 WP_000080791.1.11612 WP_000080791.1.11616 WP_000080791.1.11671 WP_000080791.1.1168 WP_000080791.1.11690 WP_000080791.1.11759 WP_000080791.1.11801 WP_000080791.1.11803 WP_000080791.1.11844 WP_000080791.1.11949 WP_000080791.1.11955 WP_000080791.1.11956 WP_000080791.1.1196 WP_000080791.1.11981 WP_000080791.1.11982 WP_000080791.1.12009 WP_000080791.1.12010 WP_000080791.1.12030 WP_000080791.1.12036 WP_000080791.1.12051 WP_000080791.1.12060 WP_000080791.1.12076 WP_000080791.1.12088 WP_000080791.1.12111 WP_000080791.1.1212 WP_000080791.1.12151 WP_000080791.1.12157 WP_000080791.1.12174 WP_000080791.1.12230 WP_000080791.1.12259 WP_000080791.1.12268 WP_000080791.1.12295 WP_000080791.1.12305 WP_000080791.1.12319 WP_000080791.1.12342 WP_000080791.1.12344 WP_000080791.1.12352 WP_000080791.1.12415 WP_000080791.1.12458 WP_000080791.1.12459 WP_000080791.1.12468 WP_000080791.1.12478 WP_000080791.1.12542 WP_000080791.1.12552 WP_000080791.1.12558 WP_000080791.1.12566 WP_000080791.1.12582 WP_000080791.1.12594 WP_000080791.1.12645 WP_000080791.1.12646 WP_000080791.1.12675 WP_000080791.1.12679 WP_000080791.1.12693 WP_000080791.1.127 WP_000080791.1.12709 WP_000080791.1.12717 WP_000080791.1.12743 WP_000080791.1.12749 WP_000080791.1.1275 WP_000080791.1.12756 WP_000080791.1.12761 WP_000080791.1.12763 WP_000080791.1.12775 WP_000080791.1.1278 WP_000080791.1.12781 WP_000080791.1.12826 WP_000080791.1.12830 WP_000080791.1.12831 WP_000080791.1.12876 WP_000080791.1.12893 WP_000080791.1.12914 WP_000080791.1.12915 WP_000080791.1.12944 WP_000080791.1.1295 WP_000080791.1.12956 WP_000080791.1.12976 WP_000080791.1.12991 WP_000080791.1.13002 WP_000080791.1.13031 WP_000080791.1.13060 WP_000080791.1.1308 WP_000080791.1.13117 WP_000080791.1.1312 WP_000080791.1.13136 WP_000080791.1.13144 WP_000080791.1.1315 WP_000080791.1.13176 WP_000080791.1.13181 WP_000080791.1.13205 WP_000080791.1.13217 WP_000080791.1.13222 WP_000080791.1.13223 WP_000080791.1.1323 WP_000080791.1.13239 WP_000080791.1.13258 WP_000080791.1.13272 WP_000080791.1.13281 WP_000080791.1.13290 WP_000080791.1.13301 WP_000080791.1.13332 WP_000080791.1.13333 WP_000080791.1.13348 WP_000080791.1.1335 WP_000080791.1.13393 WP_000080791.1.13409 WP_000080791.1.1343 WP_000080791.1.13430 WP_000080791.1.13442 WP_000080791.1.1345 WP_000080791.1.13469 WP_000080791.1.13473 WP_000080791.1.13481 WP_000080791.1.13492 WP_000080791.1.13495 WP_000080791.1.13525 WP_000080791.1.13585 WP_000080791.1.13600 WP_000080791.1.13608 WP_000080791.1.13618 WP_000080791.1.13626 WP_000080791.1.13644 WP_000080791.1.13656 WP_000080791.1.13664 WP_000080791.1.13778 WP_000080791.1.13798 WP_000080791.1.13824 WP_000080791.1.13877 WP_000080791.1.13881 WP_000080791.1.13924 WP_000080791.1.13934 WP_000080791.1.13936 WP_000080791.1.13939 WP_000080791.1.13944 WP_000080791.1.13949 WP_000080791.1.13974 WP_000080791.1.14023 WP_000080791.1.14030 WP_000080791.1.14058 WP_000080791.1.14070 WP_000080791.1.14110 WP_000080791.1.14144 WP_000080791.1.14164 WP_000080791.1.1419 WP_000080791.1.14245 WP_000080791.1.14253 WP_000080791.1.14277 WP_000080791.1.14292 WP_000080791.1.14304 WP_000080791.1.14322 WP_000080791.1.14346 WP_000080791.1.14371 WP_000080791.1.1438 WP_000080791.1.14389 WP_000080791.1.14398 WP_000080791.1.14432 WP_000080791.1.14445 WP_000080791.1.14468 WP_000080791.1.14493 WP_000080791.1.14501 WP_000080791.1.14506 WP_000080791.1.14508 WP_000080791.1.14509 WP_000080791.1.14529 WP_000080791.1.14536 WP_000080791.1.14538 WP_000080791.1.14581 WP_000080791.1.14582 WP_000080791.1.14600 WP_000080791.1.14601 WP_000080791.1.1461 WP_000080791.1.14616 WP_000080791.1.14621 WP_000080791.1.14693 WP_000080791.1.1470 WP_000080791.1.14712 WP_000080791.1.14748 WP_000080791.1.14749 WP_000080791.1.14807 WP_000080791.1.14811 WP_000080791.1.14833 WP_000080791.1.14871 WP_000080791.1.14914 WP_000080791.1.14934 WP_000080791.1.14935 WP_000080791.1.14946 WP_000080791.1.14956 WP_000080791.1.14963 WP_000080791.1.14977 WP_000080791.1.14992 WP_000080791.1.15020 WP_000080791.1.15041 WP_000080791.1.1510 WP_000080791.1.15117 WP_000080791.1.1512 WP_000080791.1.15121 WP_000080791.1.15138 WP_000080791.1.15177 WP_000080791.1.15193 WP_000080791.1.15207 WP_000080791.1.15221 WP_000080791.1.1524 WP_000080791.1.15259 WP_000080791.1.15270 WP_000080791.1.15274 WP_000080791.1.15277 WP_000080791.1.15282 WP_000080791.1.15290 WP_000080791.1.15335 WP_000080791.1.15347 WP_000080791.1.15356 WP_000080791.1.15416 WP_000080791.1.15420 WP_000080791.1.1543 WP_000080791.1.15444 WP_000080791.1.15496 WP_000080791.1.1550 WP_000080791.1.15503 WP_000080791.1.15521 WP_000080791.1.15527 WP_000080791.1.15528 WP_000080791.1.15538 WP_000080791.1.15576 WP_000080791.1.15583 WP_000080791.1.15593 WP_000080791.1.15600 WP_000080791.1.1561 WP_000080791.1.15624 WP_000080791.1.15626 WP_000080791.1.15645 WP_000080791.1.15654 WP_000080791.1.15702 WP_000080791.1.15740 WP_000080791.1.15747 WP_000080791.1.15752 WP_000080791.1.15768 WP_000080791.1.15782 WP_000080791.1.15791 WP_000080791.1.15809 WP_000080791.1.1582 WP_000080791.1.15855 WP_000080791.1.15857 WP_000080791.1.15863 WP_000080791.1.15869 WP_000080791.1.1588 WP_000080791.1.15916 WP_000080791.1.15945 WP_000080791.1.15949 WP_000080791.1.15984 WP_000080791.1.15990 WP_000080791.1.16010 WP_000080791.1.16014 WP_000080791.1.16034 WP_000080791.1.1604 WP_000080791.1.16067 WP_000080791.1.16075 WP_000080791.1.16086 WP_000080791.1.16087 WP_000080791.1.1609 WP_000080791.1.16102 WP_000080791.1.16111 WP_000080791.1.16117 WP_000080791.1.16131 WP_000080791.1.16133 WP_000080791.1.16175 WP_000080791.1.16179 WP_000080791.1.16183 WP_000080791.1.16194 WP_000080791.1.1622 WP_000080791.1.16222 WP_000080791.1.16272 WP_000080791.1.16294 WP_000080791.1.163 WP_000080791.1.16322 WP_000080791.1.1634 WP_000080791.1.16387 WP_000080791.1.16388 WP_000080791.1.16396 WP_000080791.1.1640 WP_000080791.1.16435 WP_000080791.1.16463 WP_000080791.1.16481 WP_000080791.1.16500 WP_000080791.1.16517 WP_000080791.1.16532 WP_000080791.1.16539 WP_000080791.1.16541 WP_000080791.1.1655 WP_000080791.1.16577 WP_000080791.1.16612 WP_000080791.1.16667 WP_000080791.1.16700 WP_000080791.1.16705 WP_000080791.1.16715 WP_000080791.1.16721 WP_000080791.1.16745 WP_000080791.1.16752 WP_000080791.1.16766 WP_000080791.1.16799 WP_000080791.1.16805 WP_000080791.1.16807 WP_000080791.1.16818 WP_000080791.1.16843 WP_000080791.1.16845 WP_000080791.1.16861 WP_000080791.1.16862 WP_000080791.1.16927 WP_000080791.1.16979 WP_000080791.1.17014 WP_000080791.1.17018 WP_000080791.1.17061 WP_000080791.1.17087 WP_000080791.1.1710 WP_000080791.1.17102 WP_000080791.1.17109 WP_000080791.1.17111 WP_000080791.1.17114 WP_000080791.1.17123 WP_000080791.1.17150 WP_000080791.1.17153 WP_000080791.1.17170 WP_000080791.1.17172 WP_000080791.1.17182 WP_000080791.1.17187 WP_000080791.1.17206 WP_000080791.1.17216 WP_000080791.1.17241 WP_000080791.1.17242 WP_000080791.1.17290 WP_000080791.1.17297 WP_000080791.1.1731 WP_000080791.1.17325 WP_000080791.1.17333 WP_000080791.1.17356 WP_000080791.1.17360 WP_000080791.1.17373 WP_000080791.1.17386 WP_000080791.1.17403 WP_000080791.1.17415 WP_000080791.1.17432 WP_000080791.1.17461 WP_000080791.1.17464 WP_000080791.1.17496 WP_000080791.1.17534 WP_000080791.1.1755 WP_000080791.1.17550 WP_000080791.1.17577 WP_000080791.1.17584 WP_000080791.1.17595 WP_000080791.1.17623 WP_000080791.1.1763 WP_000080791.1.17637 WP_000080791.1.1766 WP_000080791.1.1769 WP_000080791.1.17701 WP_000080791.1.17734 WP_000080791.1.17757 WP_000080791.1.17766 WP_000080791.1.17829 WP_000080791.1.17831 WP_000080791.1.17849 WP_000080791.1.17889 WP_000080791.1.17904 WP_000080791.1.17920 WP_000080791.1.17925 WP_000080791.1.17937 WP_000080791.1.17952 WP_000080791.1.17961 WP_000080791.1.17963 WP_000080791.1.17984 WP_000080791.1.18000 WP_000080791.1.1802 WP_000080791.1.18024 WP_000080791.1.18050 WP_000080791.1.18064 WP_000080791.1.18094 WP_000080791.1.18112 WP_000080791.1.18118 WP_000080791.1.18121 WP_000080791.1.18133 WP_000080791.1.18134 WP_000080791.1.18136 WP_000080791.1.18164 WP_000080791.1.18175 WP_000080791.1.18225 WP_000080791.1.18226 WP_000080791.1.18229 WP_000080791.1.18316 WP_000080791.1.18326 WP_000080791.1.18337 WP_000080791.1.18338 WP_000080791.1.1834 WP_000080791.1.18340 WP_000080791.1.18348 WP_000080791.1.18381 WP_000080791.1.18394 WP_000080791.1.18402 WP_000080791.1.18420 WP_000080791.1.18436 WP_000080791.1.18438 WP_000080791.1.18458 WP_000080791.1.18472 WP_000080791.1.18530 WP_000080791.1.18550 WP_000080791.1.18556 WP_000080791.1.18588 WP_000080791.1.18617 WP_000080791.1.18649 WP_000080791.1.18650 WP_000080791.1.18655 WP_000080791.1.1866 WP_000080791.1.18666 WP_000080791.1.1867 WP_000080791.1.18699 WP_000080791.1.18714 WP_000080791.1.18725 WP_000080791.1.18726 WP_000080791.1.1873 WP_000080791.1.18734 WP_000080791.1.18794 WP_000080791.1.18801 WP_000080791.1.18802 WP_000080791.1.1881 WP_000080791.1.18828 WP_000080791.1.18837 WP_000080791.1.18876 WP_000080791.1.18899 WP_000080791.1.18908 WP_000080791.1.18934 WP_000080791.1.18936 WP_000080791.1.1896 WP_000080791.1.18962 WP_000080791.1.18995 WP_000080791.1.19036 WP_000080791.1.19039 WP_000080791.1.1906 WP_000080791.1.1909 WP_000080791.1.19090 WP_000080791.1.191 WP_000080791.1.19100 WP_000080791.1.19140 WP_000080791.1.19146 WP_000080791.1.19147 WP_000080791.1.19150 WP_000080791.1.19153 WP_000080791.1.19171 WP_000080791.1.19194 WP_000080791.1.19205 WP_000080791.1.19206 WP_000080791.1.19245 WP_000080791.1.1925 WP_000080791.1.19277 WP_000080791.1.193 WP_000080791.1.19312 WP_000080791.1.19313 WP_000080791.1.19332 WP_000080791.1.19350 WP_000080791.1.19374 WP_000080791.1.19379 WP_000080791.1.19389 WP_000080791.1.19419 WP_000080791.1.19424 WP_000080791.1.19441 WP_000080791.1.19448 WP_000080791.1.19465 WP_000080791.1.19492 WP_000080791.1.19494 WP_000080791.1.19534 WP_000080791.1.19544 WP_000080791.1.19547 WP_000080791.1.19557 WP_000080791.1.19581 WP_000080791.1.19583 WP_000080791.1.19593 WP_000080791.1.1960 WP_000080791.1.1963 WP_000080791.1.19644 WP_000080791.1.19649 WP_000080791.1.19651 WP_000080791.1.19654 WP_000080791.1.19655 WP_000080791.1.19661 WP_000080791.1.19684 WP_000080791.1.19691 WP_000080791.1.19760 WP_000080791.1.19761 WP_000080791.1.19778 WP_000080791.1.1982 WP_000080791.1.19840 WP_000080791.1.19847 WP_000080791.1.19861 WP_000080791.1.1987 WP_000080791.1.19878 WP_000080791.1.19889 WP_000080791.1.19940 WP_000080791.1.19957 WP_000080791.1.19972 WP_000080791.1.19994 WP_000080791.1.2005 WP_000080791.1.20114 WP_000080791.1.20115 WP_000080791.1.20129 WP_000080791.1.20133 WP_000080791.1.20151 WP_000080791.1.20159 WP_000080791.1.20164 WP_000080791.1.20170 WP_000080791.1.20183 WP_000080791.1.20224 WP_000080791.1.20238 WP_000080791.1.20251 WP_000080791.1.20264 WP_000080791.1.2027 WP_000080791.1.20277 WP_000080791.1.20308 WP_000080791.1.20318 WP_000080791.1.20325 WP_000080791.1.20331 WP_000080791.1.20334 WP_000080791.1.20388 WP_000080791.1.20445 WP_000080791.1.20449 WP_000080791.1.20452 WP_000080791.1.20480 WP_000080791.1.20483 WP_000080791.1.20493 WP_000080791.1.20506 WP_000080791.1.20515 WP_000080791.1.20519 WP_000080791.1.20536 WP_000080791.1.20546 WP_000080791.1.20549 WP_000080791.1.20575 WP_000080791.1.20594 WP_000080791.1.2063 WP_000080791.1.20638 WP_000080791.1.20640 WP_000080791.1.20691 WP_000080791.1.20709 WP_000080791.1.20724 WP_000080791.1.20730 WP_000080791.1.20737 WP_000080791.1.20741 WP_000080791.1.20745 WP_000080791.1.20761 WP_000080791.1.20784 WP_000080791.1.20785 WP_000080791.1.20803 WP_000080791.1.20824 WP_000080791.1.20841 WP_000080791.1.20848 WP_000080791.1.20863 WP_000080791.1.2089 WP_000080791.1.20893 WP_000080791.1.20907 WP_000080791.1.2092 WP_000080791.1.20933 WP_000080791.1.20941 WP_000080791.1.20943 WP_000080791.1.20950 WP_000080791.1.20958 WP_000080791.1.20962 WP_000080791.1.20982 WP_000080791.1.20989 WP_000080791.1.2100 WP_000080791.1.21017 WP_000080791.1.21020 WP_000080791.1.21024 WP_000080791.1.21033 WP_000080791.1.21041 WP_000080791.1.21057 WP_000080791.1.21104 WP_000080791.1.21122 WP_000080791.1.21137 WP_000080791.1.21152 WP_000080791.1.21236 WP_000080791.1.21251 WP_000080791.1.21266 WP_000080791.1.21336 WP_000080791.1.21378 WP_000080791.1.2142 WP_000080791.1.21441 WP_000080791.1.21450 WP_000080791.1.21455 WP_000080791.1.21470 WP_000080791.1.21508 WP_000080791.1.21537 WP_000080791.1.2156 WP_000080791.1.21573 WP_000080791.1.21614 WP_000080791.1.21628 WP_000080791.1.21634 WP_000080791.1.21652 WP_000080791.1.21656 WP_000080791.1.21661 WP_000080791.1.21666 WP_000080791.1.21667 WP_000080791.1.21668 WP_000080791.1.21696 WP_000080791.1.21714 WP_000080791.1.21729 WP_000080791.1.21732 WP_000080791.1.21733 WP_000080791.1.21758 WP_000080791.1.21771 WP_000080791.1.21773 WP_000080791.1.21899 WP_000080791.1.21915 WP_000080791.1.21945 WP_000080791.1.21962 WP_000080791.1.21992 WP_000080791.1.22021 WP_000080791.1.22042 WP_000080791.1.22060 WP_000080791.1.22088 WP_000080791.1.22113 WP_000080791.1.22138 WP_000080791.1.22161 WP_000080791.1.2218 WP_000080791.1.22182 WP_000080791.1.22189 WP_000080791.1.22203 WP_000080791.1.22204 WP_000080791.1.22251 WP_000080791.1.22269 WP_000080791.1.22272 WP_000080791.1.22280 WP_000080791.1.22291 WP_000080791.1.22293 WP_000080791.1.22304 WP_000080791.1.22363 WP_000080791.1.22381 WP_000080791.1.2242 WP_000080791.1.2245 WP_000080791.1.22450 WP_000080791.1.22464 WP_000080791.1.22494 WP_000080791.1.22508 WP_000080791.1.22543 WP_000080791.1.22544 WP_000080791.1.22549 WP_000080791.1.22574 WP_000080791.1.22576 WP_000080791.1.22579 WP_000080791.1.22594 WP_000080791.1.22602 WP_000080791.1.22631 WP_000080791.1.22632 WP_000080791.1.22649 WP_000080791.1.22667 WP_000080791.1.22669 WP_000080791.1.22685 WP_000080791.1.22690 WP_000080791.1.22743 WP_000080791.1.22757 WP_000080791.1.22765 WP_000080791.1.22777 WP_000080791.1.22783 WP_000080791.1.22824 WP_000080791.1.22830 WP_000080791.1.22868 WP_000080791.1.22878 WP_000080791.1.22885 WP_000080791.1.22908 WP_000080791.1.22917 WP_000080791.1.22925 WP_000080791.1.22939 WP_000080791.1.22993 WP_000080791.1.2300 WP_000080791.1.23005 WP_000080791.1.23021 WP_000080791.1.23026 WP_000080791.1.23035 WP_000080791.1.23044 WP_000080791.1.23073 WP_000080791.1.23078 WP_000080791.1.23090 WP_000080791.1.23092 WP_000080791.1.23109 WP_000080791.1.23115 WP_000080791.1.23135 WP_000080791.1.2322 WP_000080791.1.23230 WP_000080791.1.23241 WP_000080791.1.2325 WP_000080791.1.23282 WP_000080791.1.23290 WP_000080791.1.23299 WP_000080791.1.23323 WP_000080791.1.23330 WP_000080791.1.23351 WP_000080791.1.23355 WP_000080791.1.23378 WP_000080791.1.23383 WP_000080791.1.23393 WP_000080791.1.23435 WP_000080791.1.23467 WP_000080791.1.23486 WP_000080791.1.23487 WP_000080791.1.23511 WP_000080791.1.23522 WP_000080791.1.23527 WP_000080791.1.23549 WP_000080791.1.23575 WP_000080791.1.23593 WP_000080791.1.2362 WP_000080791.1.23625 WP_000080791.1.23640 WP_000080791.1.23686 WP_000080791.1.23693 WP_000080791.1.23700 WP_000080791.1.23711 WP_000080791.1.23724 WP_000080791.1.23741 WP_000080791.1.23754 WP_000080791.1.23790 WP_000080791.1.23804 WP_000080791.1.23806 WP_000080791.1.23812 WP_000080791.1.23838 WP_000080791.1.23840 WP_000080791.1.23869 WP_000080791.1.2388 WP_000080791.1.23890 WP_000080791.1.23895 WP_000080791.1.23898 WP_000080791.1.23899 WP_000080791.1.23915 WP_000080791.1.23945 WP_000080791.1.23950 WP_000080791.1.23953 WP_000080791.1.23960 WP_000080791.1.23962 WP_000080791.1.23973 WP_000080791.1.23984 WP_000080791.1.23985 WP_000080791.1.24004 WP_000080791.1.24024 WP_000080791.1.24038 WP_000080791.1.24045 WP_000080791.1.24068 WP_000080791.1.24070 WP_000080791.1.24088 WP_000080791.1.24124 WP_000080791.1.24127 WP_000080791.1.24136 WP_000080791.1.24169 WP_000080791.1.24177 WP_000080791.1.2428 WP_000080791.1.24283 WP_000080791.1.24304 WP_000080791.1.24316 WP_000080791.1.24341 WP_000080791.1.24362 WP_000080791.1.24374 WP_000080791.1.24381 WP_000080791.1.24383 WP_000080791.1.24458 WP_000080791.1.24460 WP_000080791.1.24473 WP_000080791.1.24483 WP_000080791.1.2449 WP_000080791.1.24523 WP_000080791.1.24524 WP_000080791.1.24536 WP_000080791.1.24575 WP_000080791.1.24577 WP_000080791.1.24583 WP_000080791.1.24616 WP_000080791.1.24641 WP_000080791.1.24646 WP_000080791.1.2469 WP_000080791.1.24703 WP_000080791.1.24752 WP_000080791.1.24753 WP_000080791.1.24758 WP_000080791.1.24763 WP_000080791.1.24773 WP_000080791.1.24797 WP_000080791.1.24808 WP_000080791.1.24854 WP_000080791.1.24870 WP_000080791.1.24899 WP_000080791.1.24906 WP_000080791.1.24909 WP_000080791.1.24939 WP_000080791.1.24946 WP_000080791.1.24960 WP_000080791.1.24979 WP_000080791.1.24984 WP_000080791.1.25019 WP_000080791.1.25021 WP_000080791.1.2504 WP_000080791.1.25042 WP_000080791.1.25050 WP_000080791.1.25076 WP_000080791.1.25079 WP_000080791.1.25085 WP_000080791.1.25086 WP_000080791.1.25088 WP_000080791.1.2512 WP_000080791.1.25126 WP_000080791.1.25141 WP_000080791.1.25174 WP_000080791.1.25183 WP_000080791.1.25193 WP_000080791.1.25201 WP_000080791.1.25203 WP_000080791.1.25270 WP_000080791.1.25305 WP_000080791.1.2531 WP_000080791.1.25312 WP_000080791.1.25324 WP_000080791.1.25372 WP_000080791.1.25378 WP_000080791.1.25380 WP_000080791.1.2540 WP_000080791.1.25420 WP_000080791.1.2543 WP_000080791.1.25446 WP_000080791.1.25480 WP_000080791.1.25525 WP_000080791.1.25526 WP_000080791.1.25577 WP_000080791.1.2558 WP_000080791.1.25592 WP_000080791.1.25612 WP_000080791.1.25613 WP_000080791.1.25631 WP_000080791.1.25643 WP_000080791.1.2567 WP_000080791.1.25680 WP_000080791.1.25681 WP_000080791.1.25701 WP_000080791.1.25712 WP_000080791.1.25713 WP_000080791.1.25724 WP_000080791.1.25726 WP_000080791.1.25755 WP_000080791.1.25794 WP_000080791.1.25819 WP_000080791.1.25831 WP_000080791.1.25832 WP_000080791.1.25843 WP_000080791.1.25869 WP_000080791.1.25873 WP_000080791.1.25886 WP_000080791.1.25895 WP_000080791.1.2597 WP_000080791.1.25996 WP_000080791.1.26040 WP_000080791.1.26048 WP_000080791.1.26055 WP_000080791.1.2606 WP_000080791.1.26066 WP_000080791.1.26076 WP_000080791.1.26092 WP_000080791.1.26100 WP_000080791.1.26105 WP_000080791.1.26121 WP_000080791.1.26125 WP_000080791.1.26130 WP_000080791.1.26131 WP_000080791.1.26134 WP_000080791.1.26150 WP_000080791.1.26161 WP_000080791.1.26175 WP_000080791.1.26186 WP_000080791.1.26189 WP_000080791.1.26196 WP_000080791.1.26246 WP_000080791.1.26259 WP_000080791.1.26264 WP_000080791.1.26270 WP_000080791.1.26284 WP_000080791.1.26304 WP_000080791.1.26325 WP_000080791.1.26331 WP_000080791.1.2637 WP_000080791.1.26379 WP_000080791.1.26398 WP_000080791.1.26403 WP_000080791.1.2642 WP_000080791.1.26438 WP_000080791.1.26474 WP_000080791.1.26479 WP_000080791.1.26480 WP_000080791.1.26517 WP_000080791.1.26525 WP_000080791.1.26569 WP_000080791.1.26574 WP_000080791.1.26579 WP_000080791.1.26588 WP_000080791.1.26590 WP_000080791.1.26598 WP_000080791.1.26609 WP_000080791.1.26613 WP_000080791.1.26627 WP_000080791.1.2665 WP_000080791.1.26658 WP_000080791.1.26659 WP_000080791.1.26660 WP_000080791.1.26683 WP_000080791.1.26688 WP_000080791.1.26716 WP_000080791.1.26720 WP_000080791.1.26761 WP_000080791.1.26782 WP_000080791.1.26837 WP_000080791.1.26861 WP_000080791.1.26878 WP_000080791.1.2688 WP_000080791.1.26912 WP_000080791.1.26941 WP_000080791.1.2695 WP_000080791.1.26950 WP_000080791.1.26975 WP_000080791.1.26987 WP_000080791.1.26995 WP_000080791.1.26998 WP_000080791.1.2700 WP_000080791.1.27019 WP_000080791.1.27043 WP_000080791.1.27057 WP_000080791.1.27060 WP_000080791.1.27091 WP_000080791.1.27098 WP_000080791.1.27101 WP_000080791.1.2712 WP_000080791.1.27134 WP_000080791.1.27148 WP_000080791.1.27188 WP_000080791.1.27260 WP_000080791.1.27292 WP_000080791.1.2731 WP_000080791.1.27313 WP_000080791.1.27330 WP_000080791.1.27338 WP_000080791.1.27373 WP_000080791.1.27401 WP_000080791.1.27424 WP_000080791.1.27426 WP_000080791.1.27445 WP_000080791.1.2745 WP_000080791.1.27451 WP_000080791.1.27520 WP_000080791.1.2755 WP_000080791.1.27560 WP_000080791.1.27580 WP_000080791.1.27585 WP_000080791.1.27611 WP_000080791.1.27618 WP_000080791.1.27693 WP_000080791.1.27698 WP_000080791.1.27741 WP_000080791.1.27742 WP_000080791.1.27758 WP_000080791.1.27774 WP_000080791.1.2779 WP_000080791.1.27797 WP_000080791.1.2782 WP_000080791.1.27846 WP_000080791.1.27856 WP_000080791.1.27861 WP_000080791.1.27871 WP_000080791.1.27876 WP_000080791.1.27879 WP_000080791.1.27897 WP_000080791.1.27913 WP_000080791.1.27923 WP_000080791.1.27932 WP_000080791.1.2794 WP_000080791.1.27971 WP_000080791.1.27998 WP_000080791.1.28008 WP_000080791.1.28026 WP_000080791.1.28027 WP_000080791.1.28046 WP_000080791.1.28051 WP_000080791.1.28110 WP_000080791.1.28128 WP_000080791.1.28143 WP_000080791.1.28145 WP_000080791.1.28156 WP_000080791.1.28184 WP_000080791.1.28199 WP_000080791.1.28250 WP_000080791.1.2826 WP_000080791.1.28268 WP_000080791.1.28271 WP_000080791.1.28305 WP_000080791.1.28314 WP_000080791.1.28322 WP_000080791.1.28345 WP_000080791.1.28349 WP_000080791.1.28371 WP_000080791.1.28461 WP_000080791.1.28476 WP_000080791.1.28480 WP_000080791.1.285 WP_000080791.1.28509 WP_000080791.1.28544 WP_000080791.1.28551 WP_000080791.1.28554 WP_000080791.1.2866 WP_000080791.1.28662 WP_000080791.1.28683 WP_000080791.1.28697 WP_000080791.1.28711 WP_000080791.1.28723 WP_000080791.1.28732 WP_000080791.1.28734 WP_000080791.1.28736 WP_000080791.1.28742 WP_000080791.1.28809 WP_000080791.1.28829 WP_000080791.1.28842 WP_000080791.1.28879 WP_000080791.1.28919 WP_000080791.1.28924 WP_000080791.1.28950 WP_000080791.1.28953 WP_000080791.1.28982 WP_000080791.1.28994 WP_000080791.1.290 WP_000080791.1.29001 WP_000080791.1.29013 WP_000080791.1.29016 WP_000080791.1.29026 WP_000080791.1.29049 WP_000080791.1.29055 WP_000080791.1.29061 WP_000080791.1.29082 WP_000080791.1.291 WP_000080791.1.29100 WP_000080791.1.29125 WP_000080791.1.29126 WP_000080791.1.29128 WP_000080791.1.29150 WP_000080791.1.29164 WP_000080791.1.29176 WP_000080791.1.29202 WP_000080791.1.29206 WP_000080791.1.29221 WP_000080791.1.29230 WP_000080791.1.29239 WP_000080791.1.29258 WP_000080791.1.2926 WP_000080791.1.29341 WP_000080791.1.29377 WP_000080791.1.29394 WP_000080791.1.29404 WP_000080791.1.2942 WP_000080791.1.29429 WP_000080791.1.29443 WP_000080791.1.2945 WP_000080791.1.29486 WP_000080791.1.29495 WP_000080791.1.29497 WP_000080791.1.29503 WP_000080791.1.29504 WP_000080791.1.29513 WP_000080791.1.2952 WP_000080791.1.29564 WP_000080791.1.29597 WP_000080791.1.29603 WP_000080791.1.29618 WP_000080791.1.2963 WP_000080791.1.29647 WP_000080791.1.29662 WP_000080791.1.29669 WP_000080791.1.29683 WP_000080791.1.29689 WP_000080791.1.29715 WP_000080791.1.29724 WP_000080791.1.29746 WP_000080791.1.2978 WP_000080791.1.29798 WP_000080791.1.29812 WP_000080791.1.29815 WP_000080791.1.29818 WP_000080791.1.29819 WP_000080791.1.29820 WP_000080791.1.29821 WP_000080791.1.29855 WP_000080791.1.29874 WP_000080791.1.29876 WP_000080791.1.29884 WP_000080791.1.29967 WP_000080791.1.29976 WP_000080791.1.29979 WP_000080791.1.29988 WP_000080791.1.30 WP_000080791.1.30004 WP_000080791.1.30019 WP_000080791.1.30035 WP_000080791.1.30052 WP_000080791.1.30063 WP_000080791.1.30064 WP_000080791.1.30123 WP_000080791.1.30164 WP_000080791.1.3018 WP_000080791.1.30231 WP_000080791.1.30239 WP_000080791.1.30247 WP_000080791.1.30269 WP_000080791.1.30298 WP_000080791.1.30397 WP_000080791.1.30399 WP_000080791.1.30400 WP_000080791.1.30428 WP_000080791.1.30447 WP_000080791.1.30452 WP_000080791.1.30472 WP_000080791.1.30476 WP_000080791.1.30479 WP_000080791.1.30497 WP_000080791.1.30524 WP_000080791.1.30536 WP_000080791.1.30546 WP_000080791.1.30550 WP_000080791.1.30554 WP_000080791.1.30570 WP_000080791.1.306 WP_000080791.1.30630 WP_000080791.1.30637 WP_000080791.1.30639 WP_000080791.1.30658 WP_000080791.1.30665 WP_000080791.1.30691 WP_000080791.1.30733 WP_000080791.1.30742 WP_000080791.1.30749 WP_000080791.1.30762 WP_000080791.1.30783 WP_000080791.1.30808 WP_000080791.1.3083 WP_000080791.1.30853 WP_000080791.1.30867 WP_000080791.1.30879 WP_000080791.1.30887 WP_000080791.1.30896 WP_000080791.1.309 WP_000080791.1.30905 WP_000080791.1.30918 WP_000080791.1.30987 WP_000080791.1.30993 WP_000080791.1.30999 WP_000080791.1.31000 WP_000080791.1.31009 WP_000080791.1.31017 WP_000080791.1.31029 WP_000080791.1.31055 WP_000080791.1.31083 WP_000080791.1.31089 WP_000080791.1.31119 WP_000080791.1.31129 WP_000080791.1.31142 WP_000080791.1.31188 WP_000080791.1.312 WP_000080791.1.31211 WP_000080791.1.31252 WP_000080791.1.31319 WP_000080791.1.31340 WP_000080791.1.31347 WP_000080791.1.31357 WP_000080791.1.31379 WP_000080791.1.3140 WP_000080791.1.31401 WP_000080791.1.31407 WP_000080791.1.31421 WP_000080791.1.31422 WP_000080791.1.31429 WP_000080791.1.31433 WP_000080791.1.3147 WP_000080791.1.31506 WP_000080791.1.31511 WP_000080791.1.31518 WP_000080791.1.31521 WP_000080791.1.31557 WP_000080791.1.31559 WP_000080791.1.31575 WP_000080791.1.31596 WP_000080791.1.31614 WP_000080791.1.31657 WP_000080791.1.31681 WP_000080791.1.3169 WP_000080791.1.31709 WP_000080791.1.31715 WP_000080791.1.31740 WP_000080791.1.3181 WP_000080791.1.31823 WP_000080791.1.31833 WP_000080791.1.31839 WP_000080791.1.31860 WP_000080791.1.31863 WP_000080791.1.31866 WP_000080791.1.31924 WP_000080791.1.31928 WP_000080791.1.3193 WP_000080791.1.31956 WP_000080791.1.31978 WP_000080791.1.3201 WP_000080791.1.32020 WP_000080791.1.32021 WP_000080791.1.32024 WP_000080791.1.3203 WP_000080791.1.32030 WP_000080791.1.32037 WP_000080791.1.32063 WP_000080791.1.32089 WP_000080791.1.32121 WP_000080791.1.32127 WP_000080791.1.32138 WP_000080791.1.32142 WP_000080791.1.32143 WP_000080791.1.3215 WP_000080791.1.322 WP_000080791.1.32225 WP_000080791.1.32232 WP_000080791.1.32234 WP_000080791.1.32243 WP_000080791.1.32287 WP_000080791.1.32394 WP_000080791.1.32432 WP_000080791.1.32443 WP_000080791.1.3247 WP_000080791.1.32475 WP_000080791.1.32479 WP_000080791.1.3248 WP_000080791.1.32480 WP_000080791.1.32509 WP_000080791.1.32518 WP_000080791.1.32536 WP_000080791.1.32561 WP_000080791.1.32574 WP_000080791.1.32587 WP_000080791.1.3259 WP_000080791.1.32590 WP_000080791.1.32601 WP_000080791.1.32650 WP_000080791.1.32655 WP_000080791.1.32661 WP_000080791.1.32676 WP_000080791.1.3269 WP_000080791.1.32709 WP_000080791.1.32718 WP_000080791.1.32724 WP_000080791.1.32748 WP_000080791.1.32772 WP_000080791.1.32811 WP_000080791.1.32815 WP_000080791.1.32831 WP_000080791.1.32835 WP_000080791.1.32875 WP_000080791.1.32888 WP_000080791.1.32903 WP_000080791.1.32931 WP_000080791.1.32938 WP_000080791.1.32946 WP_000080791.1.3295 WP_000080791.1.32972 WP_000080791.1.32984 WP_000080791.1.32995 WP_000080791.1.33004 WP_000080791.1.33014 WP_000080791.1.33018 WP_000080791.1.33026 WP_000080791.1.33046 WP_000080791.1.33049 WP_000080791.1.33055 WP_000080791.1.33094 WP_000080791.1.33119 WP_000080791.1.33125 WP_000080791.1.33146 WP_000080791.1.33167 WP_000080791.1.33178 WP_000080791.1.33179 WP_000080791.1.33217 WP_000080791.1.33244 WP_000080791.1.33268 WP_000080791.1.33303 WP_000080791.1.33325 WP_000080791.1.33341 WP_000080791.1.33352 WP_000080791.1.33385 WP_000080791.1.334 WP_000080791.1.33408 WP_000080791.1.33410 WP_000080791.1.33422 WP_000080791.1.33424 WP_000080791.1.33428 WP_000080791.1.3344 WP_000080791.1.33502 WP_000080791.1.33512 WP_000080791.1.33525 WP_000080791.1.33526 WP_000080791.1.3354 WP_000080791.1.33563 WP_000080791.1.33565 WP_000080791.1.33584 WP_000080791.1.33595 WP_000080791.1.33638 WP_000080791.1.33648 WP_000080791.1.33667 WP_000080791.1.33680 WP_000080791.1.33736 WP_000080791.1.33745 WP_000080791.1.33746 WP_000080791.1.33751 WP_000080791.1.33799 WP_000080791.1.33879 WP_000080791.1.33888 WP_000080791.1.33914 WP_000080791.1.33952 WP_000080791.1.33974 WP_000080791.1.33981 WP_000080791.1.3401 WP_000080791.1.34032 WP_000080791.1.34094 WP_000080791.1.3411 WP_000080791.1.34117 WP_000080791.1.34121 WP_000080791.1.34122 WP_000080791.1.34124 WP_000080791.1.34130 WP_000080791.1.342 WP_000080791.1.34204 WP_000080791.1.34208 WP_000080791.1.34224 WP_000080791.1.34269 WP_000080791.1.34270 WP_000080791.1.34294 WP_000080791.1.34303 WP_000080791.1.3432 WP_000080791.1.34332 WP_000080791.1.34341 WP_000080791.1.34362 WP_000080791.1.34363 WP_000080791.1.34383 WP_000080791.1.3444 WP_000080791.1.34444 WP_000080791.1.34456 WP_000080791.1.34500 WP_000080791.1.34525 WP_000080791.1.34528 WP_000080791.1.34532 WP_000080791.1.3460 WP_000080791.1.34617 WP_000080791.1.34683 WP_000080791.1.34686 WP_000080791.1.347 WP_000080791.1.3472 WP_000080791.1.34727 WP_000080791.1.34763 WP_000080791.1.34781 WP_000080791.1.34794 WP_000080791.1.34835 WP_000080791.1.34855 WP_000080791.1.34875 WP_000080791.1.34887 WP_000080791.1.34913 WP_000080791.1.34931 WP_000080791.1.34982 WP_000080791.1.34990 WP_000080791.1.34993 WP_000080791.1.35003 WP_000080791.1.35006 WP_000080791.1.35007 WP_000080791.1.35012 WP_000080791.1.35039 WP_000080791.1.35107 WP_000080791.1.35114 WP_000080791.1.35127 WP_000080791.1.35180 WP_000080791.1.35195 WP_000080791.1.35198 WP_000080791.1.35211 WP_000080791.1.35220 WP_000080791.1.35258 WP_000080791.1.35316 WP_000080791.1.35328 WP_000080791.1.35365 WP_000080791.1.35376 WP_000080791.1.3539 WP_000080791.1.35393 WP_000080791.1.35394 WP_000080791.1.35448 WP_000080791.1.35465 WP_000080791.1.35466 WP_000080791.1.35468 WP_000080791.1.35483 WP_000080791.1.3550 WP_000080791.1.35578 WP_000080791.1.35604 WP_000080791.1.35627 WP_000080791.1.35632 WP_000080791.1.35651 WP_000080791.1.35653 WP_000080791.1.35704 WP_000080791.1.35724 WP_000080791.1.35740 WP_000080791.1.35741 WP_000080791.1.35744 WP_000080791.1.35789 WP_000080791.1.35889 WP_000080791.1.35904 WP_000080791.1.35922 WP_000080791.1.35927 WP_000080791.1.35959 WP_000080791.1.35963 WP_000080791.1.35987 WP_000080791.1.35990 WP_000080791.1.3600 WP_000080791.1.36010 WP_000080791.1.36042 WP_000080791.1.36070 WP_000080791.1.36071 WP_000080791.1.36085 WP_000080791.1.36132 WP_000080791.1.36158 WP_000080791.1.36164 WP_000080791.1.36166 WP_000080791.1.36177 WP_000080791.1.3620 WP_000080791.1.36212 WP_000080791.1.3624 WP_000080791.1.36332 WP_000080791.1.36334 WP_000080791.1.36352 WP_000080791.1.36386 WP_000080791.1.36405 WP_000080791.1.36412 WP_000080791.1.36414 WP_000080791.1.36426 WP_000080791.1.3643 WP_000080791.1.36453 WP_000080791.1.36459 WP_000080791.1.36496 WP_000080791.1.365 WP_000080791.1.36500 WP_000080791.1.36507 WP_000080791.1.36531 WP_000080791.1.36545 WP_000080791.1.36610 WP_000080791.1.36626 WP_000080791.1.36627 WP_000080791.1.36628 WP_000080791.1.36667 WP_000080791.1.36699 WP_000080791.1.3671 WP_000080791.1.36724 WP_000080791.1.36739 WP_000080791.1.36746 WP_000080791.1.36747 WP_000080791.1.36761 WP_000080791.1.36767 WP_000080791.1.36799 WP_000080791.1.36806 WP_000080791.1.36812 WP_000080791.1.36817 WP_000080791.1.36826 WP_000080791.1.36833 WP_000080791.1.36925 WP_000080791.1.3697 WP_000080791.1.36975 WP_000080791.1.37032 WP_000080791.1.37046 WP_000080791.1.37049 WP_000080791.1.37057 WP_000080791.1.37102 WP_000080791.1.37103 WP_000080791.1.37122 WP_000080791.1.37226 WP_000080791.1.3723 WP_000080791.1.37233 WP_000080791.1.37252 WP_000080791.1.37261 WP_000080791.1.37266 WP_000080791.1.37290 WP_000080791.1.37306 WP_000080791.1.37312 WP_000080791.1.37313 WP_000080791.1.37337 WP_000080791.1.37342 WP_000080791.1.37352 WP_000080791.1.37360 WP_000080791.1.37371 WP_000080791.1.37372 WP_000080791.1.37388 WP_000080791.1.37423 WP_000080791.1.37433 WP_000080791.1.37445 WP_000080791.1.37472 WP_000080791.1.37476 WP_000080791.1.37477 WP_000080791.1.37510 WP_000080791.1.37538 WP_000080791.1.37544 WP_000080791.1.37550 WP_000080791.1.37554 WP_000080791.1.37576 WP_000080791.1.37588 WP_000080791.1.37592 WP_000080791.1.37608 WP_000080791.1.3762 WP_000080791.1.37634 WP_000080791.1.37664 WP_000080791.1.377 WP_000080791.1.3772 WP_000080791.1.37731 WP_000080791.1.37736 WP_000080791.1.37745 WP_000080791.1.37750 WP_000080791.1.37758 WP_000080791.1.37769 WP_000080791.1.37773 WP_000080791.1.37817 WP_000080791.1.37852 WP_000080791.1.37853 WP_000080791.1.3788 WP_000080791.1.37880 WP_000080791.1.37887 WP_000080791.1.37897 WP_000080791.1.37917 WP_000080791.1.37923 WP_000080791.1.37926 WP_000080791.1.3795 WP_000080791.1.3796 WP_000080791.1.37962 WP_000080791.1.37964 WP_000080791.1.37984 WP_000080791.1.37995 WP_000080791.1.37998 WP_000080791.1.38000 WP_000080791.1.38033 WP_000080791.1.38043 WP_000080791.1.38050 WP_000080791.1.38063 WP_000080791.1.38080 WP_000080791.1.38085 WP_000080791.1.38103 WP_000080791.1.38105 WP_000080791.1.38107 WP_000080791.1.3811 WP_000080791.1.38120 WP_000080791.1.3815 WP_000080791.1.38155 WP_000080791.1.38162 WP_000080791.1.38182 WP_000080791.1.38185 WP_000080791.1.38194 WP_000080791.1.38211 WP_000080791.1.3822 WP_000080791.1.38234 WP_000080791.1.38257 WP_000080791.1.38293 WP_000080791.1.38300 WP_000080791.1.38306 WP_000080791.1.38314 WP_000080791.1.38323 WP_000080791.1.38357 WP_000080791.1.38363 WP_000080791.1.38369 WP_000080791.1.38371 WP_000080791.1.38392 WP_000080791.1.38412 WP_000080791.1.38485 WP_000080791.1.38533 WP_000080791.1.38544 WP_000080791.1.38561 WP_000080791.1.38567 WP_000080791.1.38626 WP_000080791.1.38629 WP_000080791.1.38636 WP_000080791.1.38694 WP_000080791.1.38722 WP_000080791.1.3873 WP_000080791.1.38777 WP_000080791.1.38782 WP_000080791.1.38811 WP_000080791.1.38835 WP_000080791.1.38896 WP_000080791.1.389 WP_000080791.1.38911 WP_000080791.1.38935 WP_000080791.1.38950 WP_000080791.1.38956 WP_000080791.1.38958 WP_000080791.1.39005 WP_000080791.1.39037 WP_000080791.1.3904 WP_000080791.1.39103 WP_000080791.1.39123 WP_000080791.1.39164 WP_000080791.1.39167 WP_000080791.1.39180 WP_000080791.1.39196 WP_000080791.1.39209 WP_000080791.1.39232 WP_000080791.1.39254 WP_000080791.1.39268 WP_000080791.1.39289 WP_000080791.1.39302 WP_000080791.1.39310 WP_000080791.1.39313 WP_000080791.1.39325 WP_000080791.1.39327 WP_000080791.1.39356 WP_000080791.1.39365 WP_000080791.1.39377 WP_000080791.1.39401 WP_000080791.1.39402 WP_000080791.1.39423 WP_000080791.1.39430 WP_000080791.1.39492 WP_000080791.1.39509 WP_000080791.1.39531 WP_000080791.1.39541 WP_000080791.1.39564 WP_000080791.1.39594 WP_000080791.1.39601 WP_000080791.1.39607 WP_000080791.1.39626 WP_000080791.1.39646 WP_000080791.1.39651 WP_000080791.1.39690 WP_000080791.1.3970 WP_000080791.1.39708 WP_000080791.1.39713 WP_000080791.1.39717 WP_000080791.1.39733 WP_000080791.1.39734 WP_000080791.1.3980 WP_000080791.1.39809 WP_000080791.1.39818 WP_000080791.1.39820 WP_000080791.1.39822 WP_000080791.1.39829 WP_000080791.1.39867 WP_000080791.1.39870 WP_000080791.1.39938 WP_000080791.1.39961 WP_000080791.1.39966 WP_000080791.1.39973 WP_000080791.1.39998 WP_000080791.1.40 WP_000080791.1.40013 WP_000080791.1.40016 WP_000080791.1.40019 WP_000080791.1.40083 WP_000080791.1.40088 WP_000080791.1.40107 WP_000080791.1.40113 WP_000080791.1.40140 WP_000080791.1.40153 WP_000080791.1.40190 WP_000080791.1.40192 WP_000080791.1.4020 WP_000080791.1.40206 WP_000080791.1.40211 WP_000080791.1.40212 WP_000080791.1.40218 WP_000080791.1.40234 WP_000080791.1.40249 WP_000080791.1.40300 WP_000080791.1.40315 WP_000080791.1.40317 WP_000080791.1.40319 WP_000080791.1.40335 WP_000080791.1.40345 WP_000080791.1.40349 WP_000080791.1.40360 WP_000080791.1.40382 WP_000080791.1.40389 WP_000080791.1.40403 WP_000080791.1.40445 WP_000080791.1.40486 WP_000080791.1.4049 WP_000080791.1.40499 WP_000080791.1.40524 WP_000080791.1.40539 WP_000080791.1.40548 WP_000080791.1.40549 WP_000080791.1.40560 WP_000080791.1.40563 WP_000080791.1.40596 WP_000080791.1.40599 WP_000080791.1.406 WP_000080791.1.40607 WP_000080791.1.40617 WP_000080791.1.40629 WP_000080791.1.40636 WP_000080791.1.40657 WP_000080791.1.40660 WP_000080791.1.40686 WP_000080791.1.40712 WP_000080791.1.40715 WP_000080791.1.40742 WP_000080791.1.40758 WP_000080791.1.40793 WP_000080791.1.40813 WP_000080791.1.40815 WP_000080791.1.4082 WP_000080791.1.40833 WP_000080791.1.40842 WP_000080791.1.40843 WP_000080791.1.40865 WP_000080791.1.40882 WP_000080791.1.40898 WP_000080791.1.40900 WP_000080791.1.40912 WP_000080791.1.40937 WP_000080791.1.40952 WP_000080791.1.40965 WP_000080791.1.4103 WP_000080791.1.41037 WP_000080791.1.41041 WP_000080791.1.41045 WP_000080791.1.41060 WP_000080791.1.41063 WP_000080791.1.41078 WP_000080791.1.41113 WP_000080791.1.41125 WP_000080791.1.41147 WP_000080791.1.41206 WP_000080791.1.41239 WP_000080791.1.4126 WP_000080791.1.41263 WP_000080791.1.41294 WP_000080791.1.41315 WP_000080791.1.41330 WP_000080791.1.41332 WP_000080791.1.41346 WP_000080791.1.41368 WP_000080791.1.41371 WP_000080791.1.41392 WP_000080791.1.41394 WP_000080791.1.41401 WP_000080791.1.41402 WP_000080791.1.4142 WP_000080791.1.41436 WP_000080791.1.41453 WP_000080791.1.41455 WP_000080791.1.41466 WP_000080791.1.41478 WP_000080791.1.41481 WP_000080791.1.41482 WP_000080791.1.41483 WP_000080791.1.41484 WP_000080791.1.41530 WP_000080791.1.41536 WP_000080791.1.41545 WP_000080791.1.41556 WP_000080791.1.41566 WP_000080791.1.4158 WP_000080791.1.41613 WP_000080791.1.41621 WP_000080791.1.41654 WP_000080791.1.41734 WP_000080791.1.41741 WP_000080791.1.41752 WP_000080791.1.41780 WP_000080791.1.41782 WP_000080791.1.41783 WP_000080791.1.41813 WP_000080791.1.41822 WP_000080791.1.41826 WP_000080791.1.41837 WP_000080791.1.41847 WP_000080791.1.41849 WP_000080791.1.4189 WP_000080791.1.41900 WP_000080791.1.41923 WP_000080791.1.4193 WP_000080791.1.41956 WP_000080791.1.41960 WP_000080791.1.41988 WP_000080791.1.41990 WP_000080791.1.42022 WP_000080791.1.42033 WP_000080791.1.42036 WP_000080791.1.42038 WP_000080791.1.42044 WP_000080791.1.42073 WP_000080791.1.42113 WP_000080791.1.4213 WP_000080791.1.42138 WP_000080791.1.42159 WP_000080791.1.42191 WP_000080791.1.42203 WP_000080791.1.42214 WP_000080791.1.42221 WP_000080791.1.42226 WP_000080791.1.42228 WP_000080791.1.4224 WP_000080791.1.42252 WP_000080791.1.42258 WP_000080791.1.42318 WP_000080791.1.42350 WP_000080791.1.42367 WP_000080791.1.42376 WP_000080791.1.42387 WP_000080791.1.42413 WP_000080791.1.42415 WP_000080791.1.42432 WP_000080791.1.42442 WP_000080791.1.42447 WP_000080791.1.4250 WP_000080791.1.42513 WP_000080791.1.42522 WP_000080791.1.42547 WP_000080791.1.42586 WP_000080791.1.42594 WP_000080791.1.42597 WP_000080791.1.42600 WP_000080791.1.42601 WP_000080791.1.4261 WP_000080791.1.42638 WP_000080791.1.42661 WP_000080791.1.42670 WP_000080791.1.42677 WP_000080791.1.42709 WP_000080791.1.42748 WP_000080791.1.42749 WP_000080791.1.42771 WP_000080791.1.42804 WP_000080791.1.42808 WP_000080791.1.42832 WP_000080791.1.42863 WP_000080791.1.42879 WP_000080791.1.42880 WP_000080791.1.4290 WP_000080791.1.42903 WP_000080791.1.42936 WP_000080791.1.42950 WP_000080791.1.42970 WP_000080791.1.42975 WP_000080791.1.42987 WP_000080791.1.42989 WP_000080791.1.42991 WP_000080791.1.43035 WP_000080791.1.4306 WP_000080791.1.43079 WP_000080791.1.43121 WP_000080791.1.4313 WP_000080791.1.43137 WP_000080791.1.43140 WP_000080791.1.43166 WP_000080791.1.43170 WP_000080791.1.43174 WP_000080791.1.43177 WP_000080791.1.43196 WP_000080791.1.43213 WP_000080791.1.43216 WP_000080791.1.43270 WP_000080791.1.43278 WP_000080791.1.43316 WP_000080791.1.4334 WP_000080791.1.43363 WP_000080791.1.43384 WP_000080791.1.43389 WP_000080791.1.4342 WP_000080791.1.43422 WP_000080791.1.43427 WP_000080791.1.4343 WP_000080791.1.43444 WP_000080791.1.43448 WP_000080791.1.43455 WP_000080791.1.43469 WP_000080791.1.43473 WP_000080791.1.43474 WP_000080791.1.43489 WP_000080791.1.43536 WP_000080791.1.4356 WP_000080791.1.43598 WP_000080791.1.43604 WP_000080791.1.43622 WP_000080791.1.43720 WP_000080791.1.43733 WP_000080791.1.43750 WP_000080791.1.43754 WP_000080791.1.43769 WP_000080791.1.43798 WP_000080791.1.43803 WP_000080791.1.43816 WP_000080791.1.43837 WP_000080791.1.43868 WP_000080791.1.43911 WP_000080791.1.43918 WP_000080791.1.43925 WP_000080791.1.43939 WP_000080791.1.43942 WP_000080791.1.43953 WP_000080791.1.43966 WP_000080791.1.43989 WP_000080791.1.440 WP_000080791.1.44018 WP_000080791.1.44029 WP_000080791.1.44077 WP_000080791.1.44088 WP_000080791.1.44096 WP_000080791.1.44100 WP_000080791.1.44115 WP_000080791.1.44125 WP_000080791.1.4415 WP_000080791.1.44162 WP_000080791.1.44165 WP_000080791.1.44166 WP_000080791.1.44201 WP_000080791.1.44203 WP_000080791.1.44211 WP_000080791.1.44251 WP_000080791.1.44263 WP_000080791.1.44292 WP_000080791.1.44324 WP_000080791.1.44327 WP_000080791.1.44354 WP_000080791.1.44365 WP_000080791.1.44389 WP_000080791.1.44394 WP_000080791.1.44422 WP_000080791.1.44445 WP_000080791.1.44447 WP_000080791.1.44452 WP_000080791.1.44458 WP_000080791.1.44460 WP_000080791.1.44461 WP_000080791.1.4449 WP_000080791.1.44558 WP_000080791.1.44561 WP_000080791.1.44587 WP_000080791.1.4459 WP_000080791.1.44608 WP_000080791.1.44610 WP_000080791.1.44622 WP_000080791.1.4463 WP_000080791.1.44642 WP_000080791.1.44661 WP_000080791.1.44717 WP_000080791.1.44724 WP_000080791.1.4473 WP_000080791.1.44733 WP_000080791.1.44756 WP_000080791.1.44759 WP_000080791.1.44784 WP_000080791.1.44800 WP_000080791.1.44836 WP_000080791.1.44840 WP_000080791.1.44841 WP_000080791.1.44843 WP_000080791.1.44849 WP_000080791.1.44854 WP_000080791.1.44857 WP_000080791.1.44906 WP_000080791.1.44923 WP_000080791.1.44954 WP_000080791.1.44960 WP_000080791.1.44970 WP_000080791.1.44980 WP_000080791.1.45020 WP_000080791.1.45028 WP_000080791.1.45043 WP_000080791.1.45053 WP_000080791.1.45076 WP_000080791.1.45104 WP_000080791.1.45116 WP_000080791.1.45153 WP_000080791.1.4516 WP_000080791.1.45190 WP_000080791.1.45195 WP_000080791.1.45208 WP_000080791.1.45246 WP_000080791.1.45293 WP_000080791.1.4530 WP_000080791.1.45301 WP_000080791.1.45313 WP_000080791.1.45329 WP_000080791.1.45404 WP_000080791.1.45405 WP_000080791.1.4541 WP_000080791.1.45440 WP_000080791.1.45486 WP_000080791.1.4549 WP_000080791.1.45525 WP_000080791.1.45536 WP_000080791.1.45538 WP_000080791.1.45575 WP_000080791.1.45581 WP_000080791.1.45595 WP_000080791.1.45627 WP_000080791.1.45664 WP_000080791.1.45674 WP_000080791.1.45676 WP_000080791.1.45707 WP_000080791.1.45718 WP_000080791.1.4574 WP_000080791.1.45741 WP_000080791.1.45752 WP_000080791.1.4576 WP_000080791.1.45789 WP_000080791.1.45793 WP_000080791.1.45801 WP_000080791.1.45806 WP_000080791.1.4583 WP_000080791.1.45840 WP_000080791.1.45841 WP_000080791.1.45868 WP_000080791.1.45891 WP_000080791.1.45901 WP_000080791.1.45921 WP_000080791.1.4593 WP_000080791.1.45931 WP_000080791.1.45933 WP_000080791.1.45941 WP_000080791.1.45960 WP_000080791.1.45990 WP_000080791.1.4600 WP_000080791.1.46016 WP_000080791.1.46026 WP_000080791.1.46039 WP_000080791.1.46049 WP_000080791.1.46070 WP_000080791.1.46081 WP_000080791.1.46097 WP_000080791.1.46105 WP_000080791.1.46115 WP_000080791.1.46122 WP_000080791.1.4613 WP_000080791.1.46186 WP_000080791.1.4619 WP_000080791.1.46197 WP_000080791.1.46213 WP_000080791.1.46239 WP_000080791.1.46263 WP_000080791.1.46282 WP_000080791.1.46283 WP_000080791.1.46291 WP_000080791.1.46301 WP_000080791.1.46325 WP_000080791.1.46329 WP_000080791.1.46369 WP_000080791.1.46378 WP_000080791.1.46379 WP_000080791.1.46414 WP_000080791.1.46433 WP_000080791.1.46438 WP_000080791.1.46441 WP_000080791.1.46451 WP_000080791.1.4646 WP_000080791.1.4647 WP_000080791.1.46477 WP_000080791.1.46503 WP_000080791.1.46526 WP_000080791.1.46555 WP_000080791.1.46582 WP_000080791.1.46589 WP_000080791.1.46594 WP_000080791.1.46597 WP_000080791.1.46611 WP_000080791.1.46614 WP_000080791.1.46616 WP_000080791.1.46626 WP_000080791.1.46643 WP_000080791.1.46668 WP_000080791.1.4670 WP_000080791.1.46795 WP_000080791.1.46798 WP_000080791.1.46802 WP_000080791.1.46806 WP_000080791.1.46810 WP_000080791.1.46832 WP_000080791.1.46833 WP_000080791.1.46860 WP_000080791.1.46882 WP_000080791.1.46913 WP_000080791.1.46990 WP_000080791.1.46991 WP_000080791.1.46994 WP_000080791.1.46999 WP_000080791.1.47028 WP_000080791.1.47029 WP_000080791.1.47034 WP_000080791.1.47038 WP_000080791.1.47039 WP_000080791.1.47047 WP_000080791.1.47048 WP_000080791.1.47050 WP_000080791.1.47054 WP_000080791.1.47063 WP_000080791.1.47069 WP_000080791.1.4708 WP_000080791.1.47124 WP_000080791.1.47140 WP_000080791.1.47156 WP_000080791.1.47167 WP_000080791.1.47171 WP_000080791.1.47189 WP_000080791.1.4722 WP_000080791.1.47224 WP_000080791.1.47235 WP_000080791.1.47247 WP_000080791.1.4725 WP_000080791.1.47307 WP_000080791.1.47319 WP_000080791.1.47322 WP_000080791.1.47332 WP_000080791.1.47344 WP_000080791.1.47349 WP_000080791.1.47356 WP_000080791.1.47363 WP_000080791.1.47366 WP_000080791.1.47370 WP_000080791.1.47386 WP_000080791.1.4740 WP_000080791.1.47401 WP_000080791.1.47411 WP_000080791.1.47414 WP_000080791.1.47425 WP_000080791.1.4743 WP_000080791.1.47454 WP_000080791.1.47464 WP_000080791.1.47473 WP_000080791.1.47477 WP_000080791.1.47488 WP_000080791.1.47496 WP_000080791.1.47498 WP_000080791.1.47500 WP_000080791.1.47533 WP_000080791.1.47546 WP_000080791.1.47555 WP_000080791.1.47599 WP_000080791.1.47634 WP_000080791.1.47646 WP_000080791.1.47654 WP_000080791.1.47662 WP_000080791.1.47673 WP_000080791.1.47709 WP_000080791.1.4772 WP_000080791.1.47722 WP_000080791.1.47734 WP_000080791.1.47740 WP_000080791.1.47765 WP_000080791.1.47770 WP_000080791.1.47784 WP_000080791.1.47790 WP_000080791.1.47791 WP_000080791.1.47820 WP_000080791.1.47827 WP_000080791.1.4783 WP_000080791.1.47848 WP_000080791.1.47884 WP_000080791.1.47935 WP_000080791.1.47954 WP_000080791.1.4796 WP_000080791.1.47962 WP_000080791.1.47994 WP_000080791.1.48000 WP_000080791.1.48018 WP_000080791.1.48029 WP_000080791.1.48040 WP_000080791.1.48048 WP_000080791.1.48051 WP_000080791.1.48065 WP_000080791.1.48077 WP_000080791.1.48080 WP_000080791.1.48090 WP_000080791.1.48096 WP_000080791.1.4811 WP_000080791.1.48111 WP_000080791.1.4812 WP_000080791.1.48121 WP_000080791.1.48144 WP_000080791.1.48168 WP_000080791.1.48176 WP_000080791.1.48188 WP_000080791.1.48194 WP_000080791.1.48203 WP_000080791.1.48222 WP_000080791.1.48226 WP_000080791.1.48229 WP_000080791.1.48258 WP_000080791.1.4826 WP_000080791.1.48265 WP_000080791.1.48290 WP_000080791.1.48291 WP_000080791.1.48317 WP_000080791.1.48371 WP_000080791.1.48385 WP_000080791.1.48421 WP_000080791.1.48431 WP_000080791.1.48433 WP_000080791.1.48469 WP_000080791.1.48477 WP_000080791.1.48522 WP_000080791.1.4857 WP_000080791.1.48571 WP_000080791.1.486 WP_000080791.1.48620 WP_000080791.1.48629 WP_000080791.1.48678 WP_000080791.1.48697 WP_000080791.1.4871 WP_000080791.1.48712 WP_000080791.1.4876 WP_000080791.1.48792 WP_000080791.1.48801 WP_000080791.1.48806 WP_000080791.1.48827 WP_000080791.1.48847 WP_000080791.1.48860 WP_000080791.1.48902 WP_000080791.1.4892 WP_000080791.1.48926 WP_000080791.1.48954 WP_000080791.1.48970 WP_000080791.1.48974 WP_000080791.1.49001 WP_000080791.1.49061 WP_000080791.1.49076 WP_000080791.1.49107 WP_000080791.1.49124 WP_000080791.1.49147 WP_000080791.1.49170 WP_000080791.1.49179 WP_000080791.1.49190 WP_000080791.1.49229 WP_000080791.1.49236 WP_000080791.1.49258 WP_000080791.1.49312 WP_000080791.1.49332 WP_000080791.1.49336 WP_000080791.1.49338 WP_000080791.1.49342 WP_000080791.1.49347 WP_000080791.1.49363 WP_000080791.1.49401 WP_000080791.1.49412 WP_000080791.1.49446 WP_000080791.1.49464 WP_000080791.1.49483 WP_000080791.1.49496 WP_000080791.1.49521 WP_000080791.1.49522 WP_000080791.1.49531 WP_000080791.1.49537 WP_000080791.1.49567 WP_000080791.1.49594 WP_000080791.1.49599 WP_000080791.1.49615 WP_000080791.1.49621 WP_000080791.1.49625 WP_000080791.1.49645 WP_000080791.1.49655 WP_000080791.1.49661 WP_000080791.1.49662 WP_000080791.1.49675 WP_000080791.1.497 WP_000080791.1.49712 WP_000080791.1.49722 WP_000080791.1.49733 WP_000080791.1.49740 WP_000080791.1.49747 WP_000080791.1.49768 WP_000080791.1.49771 WP_000080791.1.49774 WP_000080791.1.49783 WP_000080791.1.49788 WP_000080791.1.49794 WP_000080791.1.49820 WP_000080791.1.4985 WP_000080791.1.49856 WP_000080791.1.49861 WP_000080791.1.49879 WP_000080791.1.49883 WP_000080791.1.49884 WP_000080791.1.49900 WP_000080791.1.49941 WP_000080791.1.49950 WP_000080791.1.49954 WP_000080791.1.49972 WP_000080791.1.49987 WP_000080791.1.50006 WP_000080791.1.50008 WP_000080791.1.5003 WP_000080791.1.50056 WP_000080791.1.50058 WP_000080791.1.50078 WP_000080791.1.50110 WP_000080791.1.50113 WP_000080791.1.50119 WP_000080791.1.5017 WP_000080791.1.50179 WP_000080791.1.50182 WP_000080791.1.50187 WP_000080791.1.50228 WP_000080791.1.50258 WP_000080791.1.50262 WP_000080791.1.50266 WP_000080791.1.50269 WP_000080791.1.50270 WP_000080791.1.50345 WP_000080791.1.50353 WP_000080791.1.50358 WP_000080791.1.50361 WP_000080791.1.5037 WP_000080791.1.50380 WP_000080791.1.50412 WP_000080791.1.50418 WP_000080791.1.50427 WP_000080791.1.50452 WP_000080791.1.50549 WP_000080791.1.5056 WP_000080791.1.50564 WP_000080791.1.50579 WP_000080791.1.50585 WP_000080791.1.50586 WP_000080791.1.50616 WP_000080791.1.50627 WP_000080791.1.5064 WP_000080791.1.5067 WP_000080791.1.50690 WP_000080791.1.50700 WP_000080791.1.50715 WP_000080791.1.50717 WP_000080791.1.50725 WP_000080791.1.50728 WP_000080791.1.50762 WP_000080791.1.50887 WP_000080791.1.50939 WP_000080791.1.50947 WP_000080791.1.5095 WP_000080791.1.50957 WP_000080791.1.50969 WP_000080791.1.50986 WP_000080791.1.50988 WP_000080791.1.50990 WP_000080791.1.50996 WP_000080791.1.51013 WP_000080791.1.51027 WP_000080791.1.51042 WP_000080791.1.51058 WP_000080791.1.511 WP_000080791.1.51109 WP_000080791.1.51154 WP_000080791.1.51170 WP_000080791.1.51171 WP_000080791.1.51172 WP_000080791.1.51175 WP_000080791.1.51180 WP_000080791.1.51190 WP_000080791.1.51203 WP_000080791.1.51211 WP_000080791.1.5124 WP_000080791.1.51253 WP_000080791.1.51260 WP_000080791.1.51278 WP_000080791.1.5128 WP_000080791.1.51283 WP_000080791.1.51299 WP_000080791.1.51300 WP_000080791.1.51323 WP_000080791.1.51325 WP_000080791.1.51330 WP_000080791.1.51380 WP_000080791.1.51392 WP_000080791.1.51425 WP_000080791.1.51426 WP_000080791.1.51430 WP_000080791.1.51441 WP_000080791.1.5146 WP_000080791.1.51495 WP_000080791.1.51505 WP_000080791.1.51525 WP_000080791.1.51537 WP_000080791.1.51539 WP_000080791.1.51548 WP_000080791.1.51552 WP_000080791.1.5158 WP_000080791.1.51580 WP_000080791.1.51587 WP_000080791.1.51596 WP_000080791.1.51629 WP_000080791.1.51643 WP_000080791.1.51690 WP_000080791.1.51693 WP_000080791.1.51707 WP_000080791.1.51718 WP_000080791.1.5172 WP_000080791.1.51757 WP_000080791.1.51760 WP_000080791.1.51784 WP_000080791.1.518 WP_000080791.1.51804 WP_000080791.1.51834 WP_000080791.1.51837 WP_000080791.1.51873 WP_000080791.1.51881 WP_000080791.1.51896 WP_000080791.1.51899 WP_000080791.1.51944 WP_000080791.1.51988 WP_000080791.1.52002 WP_000080791.1.52020 WP_000080791.1.52039 WP_000080791.1.52048 WP_000080791.1.52076 WP_000080791.1.52085 WP_000080791.1.52098 WP_000080791.1.52127 WP_000080791.1.52137 WP_000080791.1.5217 WP_000080791.1.52171 WP_000080791.1.52186 WP_000080791.1.52211 WP_000080791.1.52214 WP_000080791.1.52243 WP_000080791.1.5227 WP_000080791.1.52270 WP_000080791.1.52272 WP_000080791.1.52299 WP_000080791.1.52305 WP_000080791.1.52313 WP_000080791.1.52363 WP_000080791.1.52378 WP_000080791.1.5239 WP_000080791.1.52419 WP_000080791.1.52421 WP_000080791.1.52492 WP_000080791.1.52496 WP_000080791.1.52524 WP_000080791.1.52542 WP_000080791.1.52543 WP_000080791.1.52544 WP_000080791.1.52558 WP_000080791.1.52568 WP_000080791.1.52631 WP_000080791.1.5265 WP_000080791.1.52691 WP_000080791.1.52704 WP_000080791.1.5272 WP_000080791.1.52735 WP_000080791.1.52762 WP_000080791.1.52771 WP_000080791.1.52774 WP_000080791.1.52777 WP_000080791.1.52780 WP_000080791.1.52781 WP_000080791.1.52844 WP_000080791.1.5285 WP_000080791.1.52852 WP_000080791.1.52853 WP_000080791.1.52855 WP_000080791.1.52881 WP_000080791.1.52883 WP_000080791.1.52895 WP_000080791.1.52913 WP_000080791.1.52933 WP_000080791.1.52962 WP_000080791.1.52995 WP_000080791.1.53012 WP_000080791.1.53020 WP_000080791.1.53021 WP_000080791.1.53027 WP_000080791.1.53065 WP_000080791.1.53084 WP_000080791.1.53095 WP_000080791.1.5310 WP_000080791.1.53110 WP_000080791.1.53155 WP_000080791.1.53162 WP_000080791.1.53181 WP_000080791.1.532 WP_000080791.1.53211 WP_000080791.1.53223 WP_000080791.1.53228 WP_000080791.1.53238 WP_000080791.1.53242 WP_000080791.1.53244 WP_000080791.1.53251 WP_000080791.1.53262 WP_000080791.1.53270 WP_000080791.1.53356 WP_000080791.1.53364 WP_000080791.1.53377 WP_000080791.1.53401 WP_000080791.1.53410 WP_000080791.1.53415 WP_000080791.1.5342 WP_000080791.1.53428 WP_000080791.1.53537 WP_000080791.1.53545 WP_000080791.1.53556 WP_000080791.1.53587 WP_000080791.1.53594 WP_000080791.1.53645 WP_000080791.1.53649 WP_000080791.1.53687 WP_000080791.1.53693 WP_000080791.1.53769 WP_000080791.1.53809 WP_000080791.1.53810 WP_000080791.1.53866 WP_000080791.1.5391 WP_000080791.1.5393 WP_000080791.1.53931 WP_000080791.1.53940 WP_000080791.1.53966 WP_000080791.1.53972 WP_000080791.1.53978 WP_000080791.1.53991 WP_000080791.1.53994 WP_000080791.1.54002 WP_000080791.1.54024 WP_000080791.1.54028 WP_000080791.1.54051 WP_000080791.1.54091 WP_000080791.1.54095 WP_000080791.1.54102 WP_000080791.1.54104 WP_000080791.1.54144 WP_000080791.1.54169 WP_000080791.1.54188 WP_000080791.1.54202 WP_000080791.1.54208 WP_000080791.1.54213 WP_000080791.1.54263 WP_000080791.1.54307 WP_000080791.1.54313 WP_000080791.1.54317 WP_000080791.1.54328 WP_000080791.1.54329 WP_000080791.1.5434 WP_000080791.1.54359 WP_000080791.1.54388 WP_000080791.1.54394 WP_000080791.1.5441 WP_000080791.1.54417 WP_000080791.1.54418 WP_000080791.1.54429 WP_000080791.1.54439 WP_000080791.1.54454 WP_000080791.1.54507 WP_000080791.1.54524 WP_000080791.1.54534 WP_000080791.1.54546 WP_000080791.1.54590 WP_000080791.1.54591 WP_000080791.1.5460 WP_000080791.1.54602 WP_000080791.1.54605 WP_000080791.1.54617 WP_000080791.1.54620 WP_000080791.1.5467 WP_000080791.1.54695 WP_000080791.1.5470 WP_000080791.1.54754 WP_000080791.1.54769 WP_000080791.1.5478 WP_000080791.1.5479 WP_000080791.1.54798 WP_000080791.1.54817 WP_000080791.1.5486 WP_000080791.1.54883 WP_000080791.1.54918 WP_000080791.1.54927 WP_000080791.1.54940 WP_000080791.1.54972 WP_000080791.1.54981 WP_000080791.1.54991 WP_000080791.1.54993 WP_000080791.1.55003 WP_000080791.1.55005 WP_000080791.1.55009 WP_000080791.1.55041 WP_000080791.1.55115 WP_000080791.1.5512 WP_000080791.1.55123 WP_000080791.1.55149 WP_000080791.1.55151 WP_000080791.1.55179 WP_000080791.1.55185 WP_000080791.1.55197 WP_000080791.1.5520 WP_000080791.1.55203 WP_000080791.1.55218 WP_000080791.1.55273 WP_000080791.1.55275 WP_000080791.1.55286 WP_000080791.1.55338 WP_000080791.1.55357 WP_000080791.1.55374 WP_000080791.1.55381 WP_000080791.1.55417 WP_000080791.1.55420 WP_000080791.1.55425 WP_000080791.1.55466 WP_000080791.1.55472 WP_000080791.1.55492 WP_000080791.1.55507 WP_000080791.1.55529 WP_000080791.1.55550 WP_000080791.1.55551 WP_000080791.1.55552 WP_000080791.1.55556 WP_000080791.1.55563 WP_000080791.1.55571 WP_000080791.1.55574 WP_000080791.1.55597 WP_000080791.1.55608 WP_000080791.1.5561 WP_000080791.1.55629 WP_000080791.1.5570 WP_000080791.1.55709 WP_000080791.1.55720 WP_000080791.1.55730 WP_000080791.1.55731 WP_000080791.1.55744 WP_000080791.1.55787 WP_000080791.1.55790 WP_000080791.1.55791 WP_000080791.1.55808 WP_000080791.1.55825 WP_000080791.1.55838 WP_000080791.1.55844 WP_000080791.1.55868 WP_000080791.1.55870 WP_000080791.1.55888 WP_000080791.1.55892 WP_000080791.1.55896 WP_000080791.1.55897 WP_000080791.1.55936 WP_000080791.1.55981 WP_000080791.1.55988 WP_000080791.1.55990 WP_000080791.1.56033 WP_000080791.1.56040 WP_000080791.1.56072 WP_000080791.1.561 WP_000080791.1.56122 WP_000080791.1.56139 WP_000080791.1.5614 WP_000080791.1.56142 WP_000080791.1.56149 WP_000080791.1.56151 WP_000080791.1.5616 WP_000080791.1.56177 WP_000080791.1.56193 WP_000080791.1.56197 WP_000080791.1.562 WP_000080791.1.56278 WP_000080791.1.56285 WP_000080791.1.56302 WP_000080791.1.5632 WP_000080791.1.56338 WP_000080791.1.56371 WP_000080791.1.5639 WP_000080791.1.56392 WP_000080791.1.56402 WP_000080791.1.56436 WP_000080791.1.56457 WP_000080791.1.5646 WP_000080791.1.56469 WP_000080791.1.56481 WP_000080791.1.56489 WP_000080791.1.56491 WP_000080791.1.56502 WP_000080791.1.56513 WP_000080791.1.56523 WP_000080791.1.56543 WP_000080791.1.56554 WP_000080791.1.56571 WP_000080791.1.56650 WP_000080791.1.56662 WP_000080791.1.56680 WP_000080791.1.56689 WP_000080791.1.5670 WP_000080791.1.56714 WP_000080791.1.56742 WP_000080791.1.56786 WP_000080791.1.56789 WP_000080791.1.56799 WP_000080791.1.56821 WP_000080791.1.56830 WP_000080791.1.56835 WP_000080791.1.56846 WP_000080791.1.5685 WP_000080791.1.56882 WP_000080791.1.56885 WP_000080791.1.56932 WP_000080791.1.56933 WP_000080791.1.56934 WP_000080791.1.56936 WP_000080791.1.56941 WP_000080791.1.56978 WP_000080791.1.56980 WP_000080791.1.57032 WP_000080791.1.57045 WP_000080791.1.57051 WP_000080791.1.57068 WP_000080791.1.57071 WP_000080791.1.57072 WP_000080791.1.57079 WP_000080791.1.57100 WP_000080791.1.57180 WP_000080791.1.57181 WP_000080791.1.57185 WP_000080791.1.57197 WP_000080791.1.57202 WP_000080791.1.57213 WP_000080791.1.57216 WP_000080791.1.57266 WP_000080791.1.57278 WP_000080791.1.57280 WP_000080791.1.57281 WP_000080791.1.57349 WP_000080791.1.57386 WP_000080791.1.57401 WP_000080791.1.57403 WP_000080791.1.57410 WP_000080791.1.57414 WP_000080791.1.57432 WP_000080791.1.57451 WP_000080791.1.57453 WP_000080791.1.57466 WP_000080791.1.57487 WP_000080791.1.57492 WP_000080791.1.57517 WP_000080791.1.57539 WP_000080791.1.57550 WP_000080791.1.57608 WP_000080791.1.57610 WP_000080791.1.57629 WP_000080791.1.57638 WP_000080791.1.5764 WP_000080791.1.57646 WP_000080791.1.57738 WP_000080791.1.57812 WP_000080791.1.57832 WP_000080791.1.57836 WP_000080791.1.57846 WP_000080791.1.57854 WP_000080791.1.5786 WP_000080791.1.5787 WP_000080791.1.57904 WP_000080791.1.57982 WP_000080791.1.58009 WP_000080791.1.58022 WP_000080791.1.58038 WP_000080791.1.58045 WP_000080791.1.58057 WP_000080791.1.58060 WP_000080791.1.58080 WP_000080791.1.58094 WP_000080791.1.5810 WP_000080791.1.58107 WP_000080791.1.58146 WP_000080791.1.58169 WP_000080791.1.58172 WP_000080791.1.58226 WP_000080791.1.58232 WP_000080791.1.58233 WP_000080791.1.58238 WP_000080791.1.58244 WP_000080791.1.58248 WP_000080791.1.58267 WP_000080791.1.58292 WP_000080791.1.58316 WP_000080791.1.58336 WP_000080791.1.58345 WP_000080791.1.58371 WP_000080791.1.58384 WP_000080791.1.584 WP_000080791.1.58401 WP_000080791.1.58414 WP_000080791.1.5842 WP_000080791.1.58420 WP_000080791.1.58423 WP_000080791.1.58424 WP_000080791.1.58429 WP_000080791.1.58440 WP_000080791.1.58444 WP_000080791.1.58449 WP_000080791.1.58459 WP_000080791.1.585 WP_000080791.1.58507 WP_000080791.1.58514 WP_000080791.1.5852 WP_000080791.1.58528 WP_000080791.1.58547 WP_000080791.1.58552 WP_000080791.1.58609 WP_000080791.1.58622 WP_000080791.1.58657 WP_000080791.1.58692 WP_000080791.1.58705 WP_000080791.1.58707 WP_000080791.1.58723 WP_000080791.1.58837 WP_000080791.1.58867 WP_000080791.1.58870 WP_000080791.1.58940 WP_000080791.1.58951 WP_000080791.1.58958 WP_000080791.1.58976 WP_000080791.1.58977 WP_000080791.1.58983 WP_000080791.1.59024 WP_000080791.1.59026 WP_000080791.1.59035 WP_000080791.1.59038 WP_000080791.1.59047 WP_000080791.1.59060 WP_000080791.1.59073 WP_000080791.1.59119 WP_000080791.1.59174 WP_000080791.1.59190 WP_000080791.1.59263 WP_000080791.1.5927 WP_000080791.1.59280 WP_000080791.1.59291 WP_000080791.1.59292 WP_000080791.1.59293 WP_000080791.1.59302 WP_000080791.1.59306 WP_000080791.1.59359 WP_000080791.1.59374 WP_000080791.1.59407 WP_000080791.1.59409 WP_000080791.1.59413 WP_000080791.1.5942 WP_000080791.1.59425 WP_000080791.1.59426 WP_000080791.1.59434 WP_000080791.1.59470 WP_000080791.1.59483 WP_000080791.1.59491 WP_000080791.1.59513 WP_000080791.1.59533 WP_000080791.1.59553 WP_000080791.1.59572 WP_000080791.1.59577 WP_000080791.1.59579 WP_000080791.1.59590 WP_000080791.1.59611 WP_000080791.1.59613 WP_000080791.1.59615 WP_000080791.1.59621 WP_000080791.1.5963 WP_000080791.1.5965 WP_000080791.1.59660 WP_000080791.1.59679 WP_000080791.1.59699 WP_000080791.1.59714 WP_000080791.1.59717 WP_000080791.1.59733 WP_000080791.1.59745 WP_000080791.1.59782 WP_000080791.1.59788 WP_000080791.1.59791 WP_000080791.1.59793 WP_000080791.1.59815 WP_000080791.1.59838 WP_000080791.1.59894 WP_000080791.1.59900 WP_000080791.1.59905 WP_000080791.1.59912 WP_000080791.1.59931 WP_000080791.1.59959 WP_000080791.1.59980 WP_000080791.1.59981 WP_000080791.1.59998 WP_000080791.1.6002 WP_000080791.1.60023 WP_000080791.1.60031 WP_000080791.1.60042 WP_000080791.1.60043 WP_000080791.1.60048 WP_000080791.1.60067 WP_000080791.1.60070 WP_000080791.1.60096 WP_000080791.1.60117 WP_000080791.1.6013 WP_000080791.1.60133 WP_000080791.1.60151 WP_000080791.1.6022 WP_000080791.1.60235 WP_000080791.1.60304 WP_000080791.1.60325 WP_000080791.1.60337 WP_000080791.1.60350 WP_000080791.1.60373 WP_000080791.1.60374 WP_000080791.1.60387 WP_000080791.1.60411 WP_000080791.1.60457 WP_000080791.1.60461 WP_000080791.1.60477 WP_000080791.1.60491 WP_000080791.1.60498 WP_000080791.1.60505 WP_000080791.1.60550 WP_000080791.1.60576 WP_000080791.1.6059 WP_000080791.1.60591 WP_000080791.1.60606 WP_000080791.1.6061 WP_000080791.1.60613 WP_000080791.1.60630 WP_000080791.1.6064 WP_000080791.1.60647 WP_000080791.1.60654 WP_000080791.1.6066 WP_000080791.1.60717 WP_000080791.1.60744 WP_000080791.1.60761 WP_000080791.1.60764 WP_000080791.1.60805 WP_000080791.1.60832 WP_000080791.1.60835 WP_000080791.1.60872 WP_000080791.1.60895 WP_000080791.1.61005 WP_000080791.1.61035 WP_000080791.1.61039 WP_000080791.1.61046 WP_000080791.1.6106 WP_000080791.1.61096 WP_000080791.1.61099 WP_000080791.1.6110 WP_000080791.1.61102 WP_000080791.1.61108 WP_000080791.1.61112 WP_000080791.1.61121 WP_000080791.1.61170 WP_000080791.1.61174 WP_000080791.1.61175 WP_000080791.1.61181 WP_000080791.1.61183 WP_000080791.1.61225 WP_000080791.1.61241 WP_000080791.1.61245 WP_000080791.1.61253 WP_000080791.1.61284 WP_000080791.1.613 WP_000080791.1.61360 WP_000080791.1.6138 WP_000080791.1.61442 WP_000080791.1.61445 WP_000080791.1.615 WP_000080791.1.61505 WP_000080791.1.61512 WP_000080791.1.61517 WP_000080791.1.61617 WP_000080791.1.61623 WP_000080791.1.61663 WP_000080791.1.61739 WP_000080791.1.61758 WP_000080791.1.61770 WP_000080791.1.61772 WP_000080791.1.61779 WP_000080791.1.61789 WP_000080791.1.61822 WP_000080791.1.61835 WP_000080791.1.61858 WP_000080791.1.61874 WP_000080791.1.61939 WP_000080791.1.61948 WP_000080791.1.61949 WP_000080791.1.61957 WP_000080791.1.62038 WP_000080791.1.62041 WP_000080791.1.62091 WP_000080791.1.62099 WP_000080791.1.62102 WP_000080791.1.62135 WP_000080791.1.62182 WP_000080791.1.62207 WP_000080791.1.62236 WP_000080791.1.62262 WP_000080791.1.62264 WP_000080791.1.62290 WP_000080791.1.62322 WP_000080791.1.62358 WP_000080791.1.62447 WP_000080791.1.62454 WP_000080791.1.62480 WP_000080791.1.62481 WP_000080791.1.62487 WP_000080791.1.62503 WP_000080791.1.62514 WP_000080791.1.62529 WP_000080791.1.62541 WP_000080791.1.62555 WP_000080791.1.62586 WP_000080791.1.6261 WP_000080791.1.62612 WP_000080791.1.62642 WP_000080791.1.62646 WP_000080791.1.62668 WP_000080791.1.62675 WP_000080791.1.62714 WP_000080791.1.62735 WP_000080791.1.62750 WP_000080791.1.62762 WP_000080791.1.62769 WP_000080791.1.62780 WP_000080791.1.62784 WP_000080791.1.62787 WP_000080791.1.62788 WP_000080791.1.62812 WP_000080791.1.62818 WP_000080791.1.62819 WP_000080791.1.6282 WP_000080791.1.62840 WP_000080791.1.62843 WP_000080791.1.62851 WP_000080791.1.62866 WP_000080791.1.62885 WP_000080791.1.62888 WP_000080791.1.62919 WP_000080791.1.62951 WP_000080791.1.62959 WP_000080791.1.62989 WP_000080791.1.6299 WP_000080791.1.63113 WP_000080791.1.63167 WP_000080791.1.63177 WP_000080791.1.63246 WP_000080791.1.63271 WP_000080791.1.63285 WP_000080791.1.63305 WP_000080791.1.6331 WP_000080791.1.63310 WP_000080791.1.63330 WP_000080791.1.6337 WP_000080791.1.63374 WP_000080791.1.63393 WP_000080791.1.63419 WP_000080791.1.63433 WP_000080791.1.63437 WP_000080791.1.63445 WP_000080791.1.63453 WP_000080791.1.63465 WP_000080791.1.63466 WP_000080791.1.63467 WP_000080791.1.63478 WP_000080791.1.63487 WP_000080791.1.63496 WP_000080791.1.63556 WP_000080791.1.63563 WP_000080791.1.63576 WP_000080791.1.63586 WP_000080791.1.63615 WP_000080791.1.6364 WP_000080791.1.63666 WP_000080791.1.63721 WP_000080791.1.63746 WP_000080791.1.63810 WP_000080791.1.63814 WP_000080791.1.63856 WP_000080791.1.63872 WP_000080791.1.63957 WP_000080791.1.64008 WP_000080791.1.64014 WP_000080791.1.64030 WP_000080791.1.64040 WP_000080791.1.64045 WP_000080791.1.64050 WP_000080791.1.64053 WP_000080791.1.64074 WP_000080791.1.64086 WP_000080791.1.64110 WP_000080791.1.64138 WP_000080791.1.6416 WP_000080791.1.64161 WP_000080791.1.64165 WP_000080791.1.64175 WP_000080791.1.64180 WP_000080791.1.64190 WP_000080791.1.64193 WP_000080791.1.64285 WP_000080791.1.64286 WP_000080791.1.643 WP_000080791.1.6431 WP_000080791.1.64312 WP_000080791.1.64330 WP_000080791.1.64355 WP_000080791.1.64356 WP_000080791.1.64371 WP_000080791.1.64417 WP_000080791.1.64438 WP_000080791.1.6444 WP_000080791.1.64448 WP_000080791.1.64458 WP_000080791.1.64519 WP_000080791.1.64520 WP_000080791.1.64547 WP_000080791.1.64621 WP_000080791.1.64670 WP_000080791.1.64693 WP_000080791.1.64695 WP_000080791.1.647 WP_000080791.1.64707 WP_000080791.1.64712 WP_000080791.1.64749 WP_000080791.1.64784 WP_000080791.1.64789 WP_000080791.1.64840 WP_000080791.1.64875 WP_000080791.1.64912 WP_000080791.1.64926 WP_000080791.1.64946 WP_000080791.1.6499 WP_000080791.1.64990 WP_000080791.1.6500 WP_000080791.1.65023 WP_000080791.1.65035 WP_000080791.1.65040 WP_000080791.1.65056 WP_000080791.1.65061 WP_000080791.1.65084 WP_000080791.1.65085 WP_000080791.1.65097 WP_000080791.1.65104 WP_000080791.1.6511 WP_000080791.1.65114 WP_000080791.1.65116 WP_000080791.1.65118 WP_000080791.1.65122 WP_000080791.1.65151 WP_000080791.1.65155 WP_000080791.1.65179 WP_000080791.1.65194 WP_000080791.1.65240 WP_000080791.1.65256 WP_000080791.1.6527 WP_000080791.1.65271 WP_000080791.1.65286 WP_000080791.1.65306 WP_000080791.1.65353 WP_000080791.1.65355 WP_000080791.1.65364 WP_000080791.1.65366 WP_000080791.1.65370 WP_000080791.1.65372 WP_000080791.1.654 WP_000080791.1.65405 WP_000080791.1.65408 WP_000080791.1.65413 WP_000080791.1.65415 WP_000080791.1.65493 WP_000080791.1.65565 WP_000080791.1.65571 WP_000080791.1.65596 WP_000080791.1.65606 WP_000080791.1.65749 WP_000080791.1.6576 WP_000080791.1.65834 WP_000080791.1.6587 WP_000080791.1.65875 WP_000080791.1.65898 WP_000080791.1.65912 WP_000080791.1.65957 WP_000080791.1.65961 WP_000080791.1.65962 WP_000080791.1.65963 WP_000080791.1.65978 WP_000080791.1.65988 WP_000080791.1.6599 WP_000080791.1.65991 WP_000080791.1.66001 WP_000080791.1.66007 WP_000080791.1.66016 WP_000080791.1.66017 WP_000080791.1.66022 WP_000080791.1.66044 WP_000080791.1.66050 WP_000080791.1.66071 WP_000080791.1.6609 WP_000080791.1.66100 WP_000080791.1.66104 WP_000080791.1.66121 WP_000080791.1.66127 WP_000080791.1.66161 WP_000080791.1.6618 WP_000080791.1.66181 WP_000080791.1.66251 WP_000080791.1.66255 WP_000080791.1.66280 WP_000080791.1.66288 WP_000080791.1.66290 WP_000080791.1.66295 WP_000080791.1.66327 WP_000080791.1.6635 WP_000080791.1.66376 WP_000080791.1.66387 WP_000080791.1.66389 WP_000080791.1.66392 WP_000080791.1.66395 WP_000080791.1.66421 WP_000080791.1.6645 WP_000080791.1.66501 WP_000080791.1.66511 WP_000080791.1.66523 WP_000080791.1.66531 WP_000080791.1.6654 WP_000080791.1.66559 WP_000080791.1.66566 WP_000080791.1.66624 WP_000080791.1.6665 WP_000080791.1.6666 WP_000080791.1.66667 WP_000080791.1.66668 WP_000080791.1.66700 WP_000080791.1.66706 WP_000080791.1.66708 WP_000080791.1.66719 WP_000080791.1.66727 WP_000080791.1.66751 WP_000080791.1.66758 WP_000080791.1.6676 WP_000080791.1.66783 WP_000080791.1.66787 WP_000080791.1.66849 WP_000080791.1.66873 WP_000080791.1.66922 WP_000080791.1.66926 WP_000080791.1.66933 WP_000080791.1.66948 WP_000080791.1.6698 WP_000080791.1.66984 WP_000080791.1.67018 WP_000080791.1.67022 WP_000080791.1.67026 WP_000080791.1.67047 WP_000080791.1.67055 WP_000080791.1.6706 WP_000080791.1.67073 WP_000080791.1.67102 WP_000080791.1.67132 WP_000080791.1.67136 WP_000080791.1.67137 WP_000080791.1.67150 WP_000080791.1.67153 WP_000080791.1.67158 WP_000080791.1.67164 WP_000080791.1.67174 WP_000080791.1.67194 WP_000080791.1.67200 WP_000080791.1.67209 WP_000080791.1.67210 WP_000080791.1.67214 WP_000080791.1.6723 WP_000080791.1.67258 WP_000080791.1.67272 WP_000080791.1.67284 WP_000080791.1.67293 WP_000080791.1.67373 WP_000080791.1.67383 WP_000080791.1.67415 WP_000080791.1.67427 WP_000080791.1.67446 WP_000080791.1.67452 WP_000080791.1.67456 WP_000080791.1.67464 WP_000080791.1.67468 WP_000080791.1.67495 WP_000080791.1.67522 WP_000080791.1.67533 WP_000080791.1.67538 WP_000080791.1.67553 WP_000080791.1.67581 WP_000080791.1.67606 WP_000080791.1.67663 WP_000080791.1.67669 WP_000080791.1.67676 WP_000080791.1.67681 WP_000080791.1.67685 WP_000080791.1.67690 WP_000080791.1.67701 WP_000080791.1.67724 WP_000080791.1.67726 WP_000080791.1.67732 WP_000080791.1.67737 WP_000080791.1.67753 WP_000080791.1.67758 WP_000080791.1.67760 WP_000080791.1.67775 WP_000080791.1.67780 WP_000080791.1.67786 WP_000080791.1.67787 WP_000080791.1.67788 WP_000080791.1.678 WP_000080791.1.67810 WP_000080791.1.67841 WP_000080791.1.67853 WP_000080791.1.67861 WP_000080791.1.67891 WP_000080791.1.67894 WP_000080791.1.6793 WP_000080791.1.67971 WP_000080791.1.67975 WP_000080791.1.67990 WP_000080791.1.67992 WP_000080791.1.67999 WP_000080791.1.68008 WP_000080791.1.68011 WP_000080791.1.6802 WP_000080791.1.6803 WP_000080791.1.68052 WP_000080791.1.68058 WP_000080791.1.68059 WP_000080791.1.68067 WP_000080791.1.68070 WP_000080791.1.68071 WP_000080791.1.68096 WP_000080791.1.6810 WP_000080791.1.68138 WP_000080791.1.6814 WP_000080791.1.68157 WP_000080791.1.68170 WP_000080791.1.68175 WP_000080791.1.68177 WP_000080791.1.682 WP_000080791.1.68215 WP_000080791.1.68231 WP_000080791.1.68271 WP_000080791.1.68278 WP_000080791.1.68279 WP_000080791.1.68283 WP_000080791.1.68292 WP_000080791.1.68300 WP_000080791.1.68341 WP_000080791.1.68362 WP_000080791.1.68372 WP_000080791.1.68411 WP_000080791.1.68441 WP_000080791.1.68442 WP_000080791.1.68493 WP_000080791.1.68523 WP_000080791.1.68524 WP_000080791.1.68534 WP_000080791.1.68566 WP_000080791.1.68572 WP_000080791.1.6860 WP_000080791.1.68609 WP_000080791.1.68632 WP_000080791.1.68695 WP_000080791.1.68697 WP_000080791.1.68701 WP_000080791.1.68711 WP_000080791.1.68735 WP_000080791.1.68750 WP_000080791.1.68751 WP_000080791.1.6877 WP_000080791.1.68793 WP_000080791.1.68795 WP_000080791.1.68797 WP_000080791.1.6880 WP_000080791.1.68801 WP_000080791.1.68838 WP_000080791.1.68847 WP_000080791.1.68865 WP_000080791.1.6887 WP_000080791.1.68873 WP_000080791.1.68877 WP_000080791.1.68915 WP_000080791.1.68936 WP_000080791.1.68942 WP_000080791.1.68952 WP_000080791.1.68956 WP_000080791.1.68989 WP_000080791.1.68995 WP_000080791.1.69033 WP_000080791.1.69054 WP_000080791.1.69098 WP_000080791.1.69126 WP_000080791.1.69144 WP_000080791.1.69158 WP_000080791.1.6916 WP_000080791.1.6921 WP_000080791.1.6923 WP_000080791.1.69247 WP_000080791.1.69258 WP_000080791.1.69261 WP_000080791.1.69303 WP_000080791.1.69305 WP_000080791.1.69327 WP_000080791.1.69341 WP_000080791.1.69350 WP_000080791.1.69351 WP_000080791.1.69382 WP_000080791.1.69390 WP_000080791.1.694 WP_000080791.1.6945 WP_000080791.1.69450 WP_000080791.1.69472 WP_000080791.1.69473 WP_000080791.1.69502 WP_000080791.1.69506 WP_000080791.1.69551 WP_000080791.1.69569 WP_000080791.1.69583 WP_000080791.1.69605 WP_000080791.1.69643 WP_000080791.1.69646 WP_000080791.1.69649 WP_000080791.1.697 WP_000080791.1.69716 WP_000080791.1.69735 WP_000080791.1.69780 WP_000080791.1.69803 WP_000080791.1.69810 WP_000080791.1.69818 WP_000080791.1.69831 WP_000080791.1.69832 WP_000080791.1.69872 WP_000080791.1.69887 WP_000080791.1.69896 WP_000080791.1.6993 WP_000080791.1.69963 WP_000080791.1.69972 WP_000080791.1.69999 WP_000080791.1.7001 WP_000080791.1.70063 WP_000080791.1.701 WP_000080791.1.70123 WP_000080791.1.70125 WP_000080791.1.7013 WP_000080791.1.7015 WP_000080791.1.70213 WP_000080791.1.70230 WP_000080791.1.70300 WP_000080791.1.70337 WP_000080791.1.70357 WP_000080791.1.70370 WP_000080791.1.70386 WP_000080791.1.70407 WP_000080791.1.70408 WP_000080791.1.70477 WP_000080791.1.7050 WP_000080791.1.70517 WP_000080791.1.7052 WP_000080791.1.70539 WP_000080791.1.70563 WP_000080791.1.70576 WP_000080791.1.70578 WP_000080791.1.70592 WP_000080791.1.70628 WP_000080791.1.70655 WP_000080791.1.70686 WP_000080791.1.70694 WP_000080791.1.70713 WP_000080791.1.70723 WP_000080791.1.70767 WP_000080791.1.70787 WP_000080791.1.70794 WP_000080791.1.70801 WP_000080791.1.70880 WP_000080791.1.70896 WP_000080791.1.70952 WP_000080791.1.70967 WP_000080791.1.71003 WP_000080791.1.7102 WP_000080791.1.71024 WP_000080791.1.71042 WP_000080791.1.71099 WP_000080791.1.71109 WP_000080791.1.71113 WP_000080791.1.71134 WP_000080791.1.71139 WP_000080791.1.71144 WP_000080791.1.71147 WP_000080791.1.71159 WP_000080791.1.71199 WP_000080791.1.71205 WP_000080791.1.7121 WP_000080791.1.71225 WP_000080791.1.71226 WP_000080791.1.71229 WP_000080791.1.71269 WP_000080791.1.71272 WP_000080791.1.71275 WP_000080791.1.71285 WP_000080791.1.71287 WP_000080791.1.71294 WP_000080791.1.71311 WP_000080791.1.71312 WP_000080791.1.71315 WP_000080791.1.71323 WP_000080791.1.71339 WP_000080791.1.71354 WP_000080791.1.71397 WP_000080791.1.71403 WP_000080791.1.71409 WP_000080791.1.71423 WP_000080791.1.71448 WP_000080791.1.71480 WP_000080791.1.71522 WP_000080791.1.71538 WP_000080791.1.71540 WP_000080791.1.71562 WP_000080791.1.71563 WP_000080791.1.71607 WP_000080791.1.71632 WP_000080791.1.71690 WP_000080791.1.71712 WP_000080791.1.71732 WP_000080791.1.71757 WP_000080791.1.71783 WP_000080791.1.71830 WP_000080791.1.71837 WP_000080791.1.71840 WP_000080791.1.71855 WP_000080791.1.71874 WP_000080791.1.71912 WP_000080791.1.7192 WP_000080791.1.71938 WP_000080791.1.71940 WP_000080791.1.71944 WP_000080791.1.71967 WP_000080791.1.71972 WP_000080791.1.71975 WP_000080791.1.71987 WP_000080791.1.71993 WP_000080791.1.71995 WP_000080791.1.72013 WP_000080791.1.72016 WP_000080791.1.72021 WP_000080791.1.72028 WP_000080791.1.72033 WP_000080791.1.72048 WP_000080791.1.7205 WP_000080791.1.72066 WP_000080791.1.72090 WP_000080791.1.72098 WP_000080791.1.7210 WP_000080791.1.72117 WP_000080791.1.72153 WP_000080791.1.72157 WP_000080791.1.72162 WP_000080791.1.72180 WP_000080791.1.72184 WP_000080791.1.72186 WP_000080791.1.72212 WP_000080791.1.72237 WP_000080791.1.72240 WP_000080791.1.7225 WP_000080791.1.72258 WP_000080791.1.72270 WP_000080791.1.72279 WP_000080791.1.72298 WP_000080791.1.723 WP_000080791.1.72316 WP_000080791.1.72322 WP_000080791.1.72337 WP_000080791.1.72359 WP_000080791.1.72388 WP_000080791.1.72397 WP_000080791.1.72425 WP_000080791.1.72427 WP_000080791.1.72431 WP_000080791.1.72436 WP_000080791.1.72469 WP_000080791.1.72485 WP_000080791.1.72493 WP_000080791.1.72507 WP_000080791.1.72511 WP_000080791.1.72522 WP_000080791.1.72537 WP_000080791.1.72544 WP_000080791.1.72551 WP_000080791.1.72582 WP_000080791.1.72588 WP_000080791.1.72596 WP_000080791.1.72599 WP_000080791.1.72606 WP_000080791.1.72608 WP_000080791.1.72614 WP_000080791.1.72616 WP_000080791.1.72619 WP_000080791.1.72641 WP_000080791.1.72643 WP_000080791.1.72652 WP_000080791.1.72694 WP_000080791.1.72695 WP_000080791.1.72700 WP_000080791.1.72725 WP_000080791.1.72729 WP_000080791.1.72745 WP_000080791.1.72747 WP_000080791.1.72751 WP_000080791.1.72758 WP_000080791.1.7277 WP_000080791.1.7281 WP_000080791.1.72837 WP_000080791.1.72857 WP_000080791.1.72858 WP_000080791.1.72860 WP_000080791.1.72869 WP_000080791.1.72893 WP_000080791.1.7291 WP_000080791.1.72910 WP_000080791.1.72913 WP_000080791.1.72947 WP_000080791.1.72950 WP_000080791.1.72962 WP_000080791.1.73000 WP_000080791.1.73032 WP_000080791.1.73039 WP_000080791.1.73061 WP_000080791.1.7307 WP_000080791.1.73072 WP_000080791.1.73075 WP_000080791.1.73085 WP_000080791.1.7309 WP_000080791.1.73094 WP_000080791.1.73126 WP_000080791.1.73129 WP_000080791.1.73197 WP_000080791.1.73215 WP_000080791.1.73217 WP_000080791.1.73243 WP_000080791.1.73249 WP_000080791.1.73257 WP_000080791.1.73259 WP_000080791.1.73291 WP_000080791.1.73292 WP_000080791.1.73295 WP_000080791.1.73326 WP_000080791.1.73333 WP_000080791.1.73343 WP_000080791.1.73344 WP_000080791.1.73349 WP_000080791.1.73385 WP_000080791.1.73430 WP_000080791.1.7345 WP_000080791.1.73486 WP_000080791.1.73524 WP_000080791.1.73565 WP_000080791.1.73572 WP_000080791.1.73604 WP_000080791.1.73626 WP_000080791.1.73663 WP_000080791.1.73700 WP_000080791.1.73709 WP_000080791.1.73717 WP_000080791.1.73743 WP_000080791.1.73748 WP_000080791.1.73783 WP_000080791.1.73785 WP_000080791.1.73797 WP_000080791.1.73801 WP_000080791.1.73807 WP_000080791.1.73835 WP_000080791.1.73843 WP_000080791.1.73844 WP_000080791.1.73846 WP_000080791.1.73859 WP_000080791.1.73908 WP_000080791.1.7392 WP_000080791.1.73934 WP_000080791.1.73942 WP_000080791.1.73968 WP_000080791.1.73995 WP_000080791.1.74032 WP_000080791.1.74041 WP_000080791.1.7407 WP_000080791.1.74123 WP_000080791.1.74156 WP_000080791.1.74184 WP_000080791.1.7425 WP_000080791.1.74251 WP_000080791.1.74267 WP_000080791.1.7429 WP_000080791.1.74309 WP_000080791.1.74365 WP_000080791.1.74367 WP_000080791.1.744 WP_000080791.1.74423 WP_000080791.1.74426 WP_000080791.1.74431 WP_000080791.1.74444 WP_000080791.1.74445 WP_000080791.1.7446 WP_000080791.1.74478 WP_000080791.1.74501 WP_000080791.1.74520 WP_000080791.1.74521 WP_000080791.1.74532 WP_000080791.1.74536 WP_000080791.1.74549 WP_000080791.1.74557 WP_000080791.1.74574 WP_000080791.1.7461 WP_000080791.1.74611 WP_000080791.1.74623 WP_000080791.1.74624 WP_000080791.1.74625 WP_000080791.1.74631 WP_000080791.1.74652 WP_000080791.1.74670 WP_000080791.1.74682 WP_000080791.1.74687 WP_000080791.1.74688 WP_000080791.1.74689 WP_000080791.1.74691 WP_000080791.1.74705 WP_000080791.1.74713 WP_000080791.1.74720 WP_000080791.1.74735 WP_000080791.1.7475 WP_000080791.1.74752 WP_000080791.1.74765 WP_000080791.1.74767 WP_000080791.1.7478 WP_000080791.1.74811 WP_000080791.1.74828 WP_000080791.1.74844 WP_000080791.1.74852 WP_000080791.1.74860 WP_000080791.1.74880 WP_000080791.1.74885 WP_000080791.1.74895 WP_000080791.1.74904 WP_000080791.1.74915 WP_000080791.1.74962 WP_000080791.1.74998 WP_000080791.1.75021 WP_000080791.1.75030 WP_000080791.1.75050 WP_000080791.1.75087 WP_000080791.1.75100 WP_000080791.1.75118 WP_000080791.1.75136 WP_000080791.1.75145 WP_000080791.1.7516 WP_000080791.1.75164 WP_000080791.1.75181 WP_000080791.1.75209 WP_000080791.1.75243 WP_000080791.1.75248 WP_000080791.1.75254 WP_000080791.1.75272 WP_000080791.1.7536 WP_000080791.1.75360 WP_000080791.1.75367 WP_000080791.1.75382 WP_000080791.1.7539 WP_000080791.1.75419 WP_000080791.1.75428 WP_000080791.1.75435 WP_000080791.1.75465 WP_000080791.1.75491 WP_000080791.1.75507 WP_000080791.1.75515 WP_000080791.1.75529 WP_000080791.1.75536 WP_000080791.1.75537 WP_000080791.1.75577 WP_000080791.1.75588 WP_000080791.1.75612 WP_000080791.1.75644 WP_000080791.1.75672 WP_000080791.1.75676 WP_000080791.1.75679 WP_000080791.1.75687 WP_000080791.1.75694 WP_000080791.1.75696 WP_000080791.1.75699 WP_000080791.1.75735 WP_000080791.1.75767 WP_000080791.1.75786 WP_000080791.1.75808 WP_000080791.1.7583 WP_000080791.1.75839 WP_000080791.1.75853 WP_000080791.1.75892 WP_000080791.1.75918 WP_000080791.1.75973 WP_000080791.1.75983 WP_000080791.1.75989 WP_000080791.1.75995 WP_000080791.1.75999 WP_000080791.1.76009 WP_000080791.1.76019 WP_000080791.1.76030 WP_000080791.1.76039 WP_000080791.1.76054 WP_000080791.1.76057 WP_000080791.1.76119 WP_000080791.1.76129 WP_000080791.1.7613 WP_000080791.1.76152 WP_000080791.1.7617 WP_000080791.1.76184 WP_000080791.1.76189 WP_000080791.1.76194 WP_000080791.1.76196 WP_000080791.1.76237 WP_000080791.1.76268 WP_000080791.1.76269 WP_000080791.1.76305 WP_000080791.1.76312 WP_000080791.1.76335 WP_000080791.1.76361 WP_000080791.1.76376 WP_000080791.1.76384 WP_000080791.1.76390 WP_000080791.1.76407 WP_000080791.1.76446 WP_000080791.1.76448 WP_000080791.1.76462 WP_000080791.1.76469 WP_000080791.1.76477 WP_000080791.1.76504 WP_000080791.1.76542 WP_000080791.1.76547 WP_000080791.1.76562 WP_000080791.1.76595 WP_000080791.1.76596 WP_000080791.1.7661 WP_000080791.1.76643 WP_000080791.1.76656 WP_000080791.1.76660 WP_000080791.1.76697 WP_000080791.1.76701 WP_000080791.1.76707 WP_000080791.1.76712 WP_000080791.1.76759 WP_000080791.1.7680 WP_000080791.1.76815 WP_000080791.1.76827 WP_000080791.1.76840 WP_000080791.1.76863 WP_000080791.1.76909 WP_000080791.1.76933 WP_000080791.1.76948 WP_000080791.1.76965 WP_000080791.1.76966 WP_000080791.1.77007 WP_000080791.1.77015 WP_000080791.1.77022 WP_000080791.1.77036 WP_000080791.1.77042 WP_000080791.1.77057 WP_000080791.1.77070 WP_000080791.1.77081 WP_000080791.1.77099 WP_000080791.1.771 WP_000080791.1.77109 WP_000080791.1.77128 WP_000080791.1.77147 WP_000080791.1.77162 WP_000080791.1.77163 WP_000080791.1.77173 WP_000080791.1.77175 WP_000080791.1.77200 WP_000080791.1.77204 WP_000080791.1.77214 WP_000080791.1.77224 WP_000080791.1.77239 WP_000080791.1.77253 WP_000080791.1.77258 WP_000080791.1.77275 WP_000080791.1.77290 WP_000080791.1.7731 WP_000080791.1.77320 WP_000080791.1.77341 WP_000080791.1.77392 WP_000080791.1.77408 WP_000080791.1.77419 WP_000080791.1.77432 WP_000080791.1.77437 WP_000080791.1.77462 WP_000080791.1.7747 WP_000080791.1.77470 WP_000080791.1.77477 WP_000080791.1.77487 WP_000080791.1.77511 WP_000080791.1.7756 WP_000080791.1.77581 WP_000080791.1.77595 WP_000080791.1.77608 WP_000080791.1.77626 WP_000080791.1.77636 WP_000080791.1.77643 WP_000080791.1.77644 WP_000080791.1.77648 WP_000080791.1.77657 WP_000080791.1.77707 WP_000080791.1.7775 WP_000080791.1.77760 WP_000080791.1.77767 WP_000080791.1.77768 WP_000080791.1.7780 WP_000080791.1.7781 WP_000080791.1.77816 WP_000080791.1.77826 WP_000080791.1.77833 WP_000080791.1.77876 WP_000080791.1.77929 WP_000080791.1.77949 WP_000080791.1.77950 WP_000080791.1.77961 WP_000080791.1.77979 WP_000080791.1.7799 WP_000080791.1.77999 WP_000080791.1.78000 WP_000080791.1.78007 WP_000080791.1.78010 WP_000080791.1.7804 WP_000080791.1.78063 WP_000080791.1.7808 WP_000080791.1.78089 WP_000080791.1.78099 WP_000080791.1.78102 WP_000080791.1.78131 WP_000080791.1.78183 WP_000080791.1.78187 WP_000080791.1.78188 WP_000080791.1.78196 WP_000080791.1.78232 WP_000080791.1.78233 WP_000080791.1.78235 WP_000080791.1.78297 WP_000080791.1.78305 WP_000080791.1.78321 WP_000080791.1.78337 WP_000080791.1.78368 WP_000080791.1.78376 WP_000080791.1.784 WP_000080791.1.78445 WP_000080791.1.78453 WP_000080791.1.78462 WP_000080791.1.78463 WP_000080791.1.7847 WP_000080791.1.78491 WP_000080791.1.78512 WP_000080791.1.78527 WP_000080791.1.7855 WP_000080791.1.78572 WP_000080791.1.78575 WP_000080791.1.78581 WP_000080791.1.78583 WP_000080791.1.78586 WP_000080791.1.78593 WP_000080791.1.78610 WP_000080791.1.78611 WP_000080791.1.78612 WP_000080791.1.78615 WP_000080791.1.78622 WP_000080791.1.78677 WP_000080791.1.78683 WP_000080791.1.78689 WP_000080791.1.78698 WP_000080791.1.78706 WP_000080791.1.78714 WP_000080791.1.78750 WP_000080791.1.78757 WP_000080791.1.78773 WP_000080791.1.78775 WP_000080791.1.78791 WP_000080791.1.78814 WP_000080791.1.7883 WP_000080791.1.78843 WP_000080791.1.78845 WP_000080791.1.78854 WP_000080791.1.78888 WP_000080791.1.78891 WP_000080791.1.78893 WP_000080791.1.78895 WP_000080791.1.78908 WP_000080791.1.78953 WP_000080791.1.78955 WP_000080791.1.7896 WP_000080791.1.78966 WP_000080791.1.7898 WP_000080791.1.78996 WP_000080791.1.79001 WP_000080791.1.79004 WP_000080791.1.79065 WP_000080791.1.79067 WP_000080791.1.79086 WP_000080791.1.79100 WP_000080791.1.79159 WP_000080791.1.79172 WP_000080791.1.79243 WP_000080791.1.79246 WP_000080791.1.79248 WP_000080791.1.79249 WP_000080791.1.79276 WP_000080791.1.79306 WP_000080791.1.79312 WP_000080791.1.79342 WP_000080791.1.79348 WP_000080791.1.79365 WP_000080791.1.79368 WP_000080791.1.79369 WP_000080791.1.7937 WP_000080791.1.79391 WP_000080791.1.7940 WP_000080791.1.79414 WP_000080791.1.79478 WP_000080791.1.79505 WP_000080791.1.7952 WP_000080791.1.79526 WP_000080791.1.79528 WP_000080791.1.79558 WP_000080791.1.79576 WP_000080791.1.79591 WP_000080791.1.79606 WP_000080791.1.79619 WP_000080791.1.79640 WP_000080791.1.7967 WP_000080791.1.79685 WP_000080791.1.79707 WP_000080791.1.79713 WP_000080791.1.79715 WP_000080791.1.79749 WP_000080791.1.79764 WP_000080791.1.79800 WP_000080791.1.79824 WP_000080791.1.79840 WP_000080791.1.7985 WP_000080791.1.7987 WP_000080791.1.79871 WP_000080791.1.79905 WP_000080791.1.79930 WP_000080791.1.79933 WP_000080791.1.79936 WP_000080791.1.79952 WP_000080791.1.79955 WP_000080791.1.79965 WP_000080791.1.79973 WP_000080791.1.79984 WP_000080791.1.80 WP_000080791.1.80016 WP_000080791.1.80026 WP_000080791.1.80050 WP_000080791.1.80060 WP_000080791.1.80063 WP_000080791.1.80071 WP_000080791.1.80096 WP_000080791.1.8011 WP_000080791.1.80112 WP_000080791.1.80136 WP_000080791.1.80141 WP_000080791.1.80179 WP_000080791.1.80183 WP_000080791.1.80255 WP_000080791.1.80309 WP_000080791.1.80310 WP_000080791.1.80320 WP_000080791.1.80330 WP_000080791.1.80343 WP_000080791.1.80392 WP_000080791.1.804 WP_000080791.1.80426 WP_000080791.1.80428 WP_000080791.1.80440 WP_000080791.1.80444 WP_000080791.1.80484 WP_000080791.1.80519 WP_000080791.1.80524 WP_000080791.1.80558 WP_000080791.1.80559 WP_000080791.1.8057 WP_000080791.1.80577 WP_000080791.1.80578 WP_000080791.1.80606 WP_000080791.1.80612 WP_000080791.1.80626 WP_000080791.1.80660 WP_000080791.1.80662 WP_000080791.1.8068 WP_000080791.1.80709 WP_000080791.1.80724 WP_000080791.1.80754 WP_000080791.1.80768 WP_000080791.1.80789 WP_000080791.1.80804 WP_000080791.1.80805 WP_000080791.1.80884 WP_000080791.1.8090 WP_000080791.1.80935 WP_000080791.1.80945 WP_000080791.1.80946 WP_000080791.1.80948 WP_000080791.1.80983 WP_000080791.1.80985 WP_000080791.1.810 WP_000080791.1.81026 WP_000080791.1.81032 WP_000080791.1.81034 WP_000080791.1.81054 WP_000080791.1.81056 WP_000080791.1.81070 WP_000080791.1.81098 WP_000080791.1.811 WP_000080791.1.81104 WP_000080791.1.81120 WP_000080791.1.81127 WP_000080791.1.81141 WP_000080791.1.81156 WP_000080791.1.81160 WP_000080791.1.81165 WP_000080791.1.8118 WP_000080791.1.81182 WP_000080791.1.81186 WP_000080791.1.81266 WP_000080791.1.81267 WP_000080791.1.81273 WP_000080791.1.81286 WP_000080791.1.81313 WP_000080791.1.81316 WP_000080791.1.81323 WP_000080791.1.81347 WP_000080791.1.81376 WP_000080791.1.81391 WP_000080791.1.81396 WP_000080791.1.814 WP_000080791.1.81418 WP_000080791.1.81420 WP_000080791.1.81438 WP_000080791.1.81442 WP_000080791.1.81475 WP_000080791.1.81514 WP_000080791.1.81517 WP_000080791.1.81576 WP_000080791.1.81577 WP_000080791.1.81580 WP_000080791.1.81588 WP_000080791.1.81589 WP_000080791.1.81618 WP_000080791.1.81624 WP_000080791.1.81625 WP_000080791.1.81715 WP_000080791.1.8172 WP_000080791.1.81723 WP_000080791.1.81754 WP_000080791.1.81761 WP_000080791.1.81806 WP_000080791.1.81821 WP_000080791.1.8183 WP_000080791.1.81832 WP_000080791.1.81873 WP_000080791.1.81888 WP_000080791.1.81914 WP_000080791.1.81935 WP_000080791.1.81939 WP_000080791.1.81972 WP_000080791.1.81975 WP_000080791.1.82 WP_000080791.1.82008 WP_000080791.1.82010 WP_000080791.1.82057 WP_000080791.1.82059 WP_000080791.1.82062 WP_000080791.1.82104 WP_000080791.1.82106 WP_000080791.1.82123 WP_000080791.1.82137 WP_000080791.1.82166 WP_000080791.1.82217 WP_000080791.1.82221 WP_000080791.1.82242 WP_000080791.1.82246 WP_000080791.1.82275 WP_000080791.1.82296 WP_000080791.1.82316 WP_000080791.1.8235 WP_000080791.1.82439 WP_000080791.1.82485 WP_000080791.1.82499 WP_000080791.1.82514 WP_000080791.1.82527 WP_000080791.1.82536 WP_000080791.1.82539 WP_000080791.1.8255 WP_000080791.1.82572 WP_000080791.1.82589 WP_000080791.1.82594 WP_000080791.1.82626 WP_000080791.1.82629 WP_000080791.1.82647 WP_000080791.1.82661 WP_000080791.1.8268 WP_000080791.1.82682 WP_000080791.1.82691 WP_000080791.1.82700 WP_000080791.1.82711 WP_000080791.1.82715 WP_000080791.1.82718 WP_000080791.1.82747 WP_000080791.1.82754 WP_000080791.1.8277 WP_000080791.1.82776 WP_000080791.1.82784 WP_000080791.1.82797 WP_000080791.1.82799 WP_000080791.1.82816 WP_000080791.1.82820 WP_000080791.1.82831 WP_000080791.1.82853 WP_000080791.1.82901 WP_000080791.1.82902 WP_000080791.1.8295 WP_000080791.1.82991 WP_000080791.1.83020 WP_000080791.1.83035 WP_000080791.1.83036 WP_000080791.1.83059 WP_000080791.1.8306 WP_000080791.1.8308 WP_000080791.1.83093 WP_000080791.1.83097 WP_000080791.1.83099 WP_000080791.1.831 WP_000080791.1.83118 WP_000080791.1.83127 WP_000080791.1.83144 WP_000080791.1.83151 WP_000080791.1.83205 WP_000080791.1.83218 WP_000080791.1.83224 WP_000080791.1.83238 WP_000080791.1.83253 WP_000080791.1.83256 WP_000080791.1.83313 WP_000080791.1.83347 WP_000080791.1.83375 WP_000080791.1.83393 WP_000080791.1.83415 WP_000080791.1.8345 WP_000080791.1.83481 WP_000080791.1.83506 WP_000080791.1.83537 WP_000080791.1.83544 WP_000080791.1.83564 WP_000080791.1.83582 WP_000080791.1.83584 WP_000080791.1.83644 WP_000080791.1.83668 WP_000080791.1.8368 WP_000080791.1.83684 WP_000080791.1.83712 WP_000080791.1.83735 WP_000080791.1.83762 WP_000080791.1.83781 WP_000080791.1.8384 WP_000080791.1.8386 WP_000080791.1.83879 WP_000080791.1.83911 WP_000080791.1.83936 WP_000080791.1.84004 WP_000080791.1.84014 WP_000080791.1.84021 WP_000080791.1.8405 WP_000080791.1.84059 WP_000080791.1.84060 WP_000080791.1.8408 WP_000080791.1.8411 WP_000080791.1.84140 WP_000080791.1.84172 WP_000080791.1.84197 WP_000080791.1.84210 WP_000080791.1.84215 WP_000080791.1.84219 WP_000080791.1.84221 WP_000080791.1.84264 WP_000080791.1.84298 WP_000080791.1.84312 WP_000080791.1.84313 WP_000080791.1.84316 WP_000080791.1.84326 WP_000080791.1.84331 WP_000080791.1.84339 WP_000080791.1.84348 WP_000080791.1.84405 WP_000080791.1.84410 WP_000080791.1.8444 WP_000080791.1.84464 WP_000080791.1.8447 WP_000080791.1.84482 WP_000080791.1.84484 WP_000080791.1.84486 WP_000080791.1.84531 WP_000080791.1.84534 WP_000080791.1.84584 WP_000080791.1.84635 WP_000080791.1.84639 WP_000080791.1.84656 WP_000080791.1.84657 WP_000080791.1.84668 WP_000080791.1.84697 WP_000080791.1.84738 WP_000080791.1.84740 WP_000080791.1.8477 WP_000080791.1.84784 WP_000080791.1.84850 WP_000080791.1.84875 WP_000080791.1.84877 WP_000080791.1.84881 WP_000080791.1.84894 WP_000080791.1.84941 WP_000080791.1.84966 WP_000080791.1.84972 WP_000080791.1.84977 WP_000080791.1.84989 WP_000080791.1.84994 WP_000080791.1.85002 WP_000080791.1.85011 WP_000080791.1.85025 WP_000080791.1.85052 WP_000080791.1.85077 WP_000080791.1.85090 WP_000080791.1.85106 WP_000080791.1.85112 WP_000080791.1.85138 WP_000080791.1.85155 WP_000080791.1.8517 WP_000080791.1.85175 WP_000080791.1.85188 WP_000080791.1.85216 WP_000080791.1.85247 WP_000080791.1.85252 WP_000080791.1.85253 WP_000080791.1.85255 WP_000080791.1.85260 WP_000080791.1.8530 WP_000080791.1.85310 WP_000080791.1.85315 WP_000080791.1.85320 WP_000080791.1.85323 WP_000080791.1.85329 WP_000080791.1.85336 WP_000080791.1.85384 WP_000080791.1.85504 WP_000080791.1.85525 WP_000080791.1.85554 WP_000080791.1.85556 WP_000080791.1.85558 WP_000080791.1.85578 WP_000080791.1.85593 WP_000080791.1.8560 WP_000080791.1.85623 WP_000080791.1.8564 WP_000080791.1.85657 WP_000080791.1.85722 WP_000080791.1.85752 WP_000080791.1.85762 WP_000080791.1.85772 WP_000080791.1.85781 WP_000080791.1.85806 WP_000080791.1.85857 WP_000080791.1.8592 WP_000080791.1.85939 WP_000080791.1.85944 WP_000080791.1.85948 WP_000080791.1.86001 WP_000080791.1.8603 WP_000080791.1.86035 WP_000080791.1.86104 WP_000080791.1.86105 WP_000080791.1.86110 WP_000080791.1.86149 WP_000080791.1.86161 WP_000080791.1.86166 WP_000080791.1.86171 WP_000080791.1.86176 WP_000080791.1.86179 WP_000080791.1.86189 WP_000080791.1.86196 WP_000080791.1.86210 WP_000080791.1.86225 WP_000080791.1.86227 WP_000080791.1.86234 WP_000080791.1.86255 WP_000080791.1.86261 WP_000080791.1.86266 WP_000080791.1.86276 WP_000080791.1.86283 WP_000080791.1.86294 WP_000080791.1.86307 WP_000080791.1.86340 WP_000080791.1.86353 WP_000080791.1.86355 WP_000080791.1.86364 WP_000080791.1.86371 WP_000080791.1.86376 WP_000080791.1.86412 WP_000080791.1.86437 WP_000080791.1.86451 WP_000080791.1.86452 WP_000080791.1.86461 WP_000080791.1.86475 WP_000080791.1.8652 WP_000080791.1.8656 WP_000080791.1.86560 WP_000080791.1.86574 WP_000080791.1.86586 WP_000080791.1.86598 WP_000080791.1.86609 WP_000080791.1.86613 WP_000080791.1.86617 WP_000080791.1.86640 WP_000080791.1.86673 WP_000080791.1.86681 WP_000080791.1.86691 WP_000080791.1.86707 WP_000080791.1.86717 WP_000080791.1.86727 WP_000080791.1.86731 WP_000080791.1.86753 WP_000080791.1.86760 WP_000080791.1.86768 WP_000080791.1.86833 WP_000080791.1.86848 WP_000080791.1.8687 WP_000080791.1.86956 WP_000080791.1.86959 WP_000080791.1.86994 WP_000080791.1.86997 WP_000080791.1.87043 WP_000080791.1.8705 WP_000080791.1.87067 WP_000080791.1.87074 WP_000080791.1.87075 WP_000080791.1.87076 WP_000080791.1.87102 WP_000080791.1.87109 WP_000080791.1.8711 WP_000080791.1.87147 WP_000080791.1.87189 WP_000080791.1.87199 WP_000080791.1.87205 WP_000080791.1.87247 WP_000080791.1.87249 WP_000080791.1.87254 WP_000080791.1.87310 WP_000080791.1.87358 WP_000080791.1.87371 WP_000080791.1.87382 WP_000080791.1.87389 WP_000080791.1.87400 WP_000080791.1.87410 WP_000080791.1.87443 WP_000080791.1.87491 WP_000080791.1.87504 WP_000080791.1.87557 WP_000080791.1.87563 WP_000080791.1.87568 WP_000080791.1.87574 WP_000080791.1.87581 WP_000080791.1.87590 WP_000080791.1.87607 WP_000080791.1.87610 WP_000080791.1.87616 WP_000080791.1.87633 WP_000080791.1.87655 WP_000080791.1.87675 WP_000080791.1.87694 WP_000080791.1.87696 WP_000080791.1.87721 WP_000080791.1.87728 WP_000080791.1.87738 WP_000080791.1.87766 WP_000080791.1.8778 WP_000080791.1.87788 WP_000080791.1.87789 WP_000080791.1.87822 WP_000080791.1.87857 WP_000080791.1.87883 WP_000080791.1.87914 WP_000080791.1.87919 WP_000080791.1.87980 WP_000080791.1.87990 WP_000080791.1.88017 WP_000080791.1.88020 WP_000080791.1.8807 WP_000080791.1.88082 WP_000080791.1.88088 WP_000080791.1.88110 WP_000080791.1.88119 WP_000080791.1.88147 WP_000080791.1.88149 WP_000080791.1.88197 WP_000080791.1.8822 WP_000080791.1.88234 WP_000080791.1.88260 WP_000080791.1.88285 WP_000080791.1.88304 WP_000080791.1.88336 WP_000080791.1.88376 WP_000080791.1.88427 WP_000080791.1.8843 WP_000080791.1.88434 WP_000080791.1.88462 WP_000080791.1.88467 WP_000080791.1.8848 WP_000080791.1.88499 WP_000080791.1.88505 WP_000080791.1.88524 WP_000080791.1.88527 WP_000080791.1.88528 WP_000080791.1.88535 WP_000080791.1.8855 WP_000080791.1.88557 WP_000080791.1.88562 WP_000080791.1.88607 WP_000080791.1.88631 WP_000080791.1.88667 WP_000080791.1.88709 WP_000080791.1.88710 WP_000080791.1.88711 WP_000080791.1.88717 WP_000080791.1.8873 WP_000080791.1.88732 WP_000080791.1.88752 WP_000080791.1.88767 WP_000080791.1.8879 WP_000080791.1.88793 WP_000080791.1.88803 WP_000080791.1.88826 WP_000080791.1.88834 WP_000080791.1.88883 WP_000080791.1.88891 WP_000080791.1.88941 WP_000080791.1.88953 WP_000080791.1.88961 WP_000080791.1.88997 WP_000080791.1.89043 WP_000080791.1.8906 WP_000080791.1.89067 WP_000080791.1.89069 WP_000080791.1.89090 WP_000080791.1.89099 WP_000080791.1.89150 WP_000080791.1.89163 WP_000080791.1.89165 WP_000080791.1.89197 WP_000080791.1.89203 WP_000080791.1.89214 WP_000080791.1.89217 WP_000080791.1.89285 WP_000080791.1.89312 WP_000080791.1.89322 WP_000080791.1.89334 WP_000080791.1.89351 WP_000080791.1.89379 WP_000080791.1.89385 WP_000080791.1.89396 WP_000080791.1.894 WP_000080791.1.89405 WP_000080791.1.89416 WP_000080791.1.89427 WP_000080791.1.89432 WP_000080791.1.89455 WP_000080791.1.89458 WP_000080791.1.89468 WP_000080791.1.89469 WP_000080791.1.89479 WP_000080791.1.89492 WP_000080791.1.89551 WP_000080791.1.89569 WP_000080791.1.89601 WP_000080791.1.89627 WP_000080791.1.89631 WP_000080791.1.89674 WP_000080791.1.89679 WP_000080791.1.89700 WP_000080791.1.89710 WP_000080791.1.89747 WP_000080791.1.89768 WP_000080791.1.89781 WP_000080791.1.89818 WP_000080791.1.89839 WP_000080791.1.89852 WP_000080791.1.89879 WP_000080791.1.89899 WP_000080791.1.89915 WP_000080791.1.89917 WP_000080791.1.89918 WP_000080791.1.89920 WP_000080791.1.89923 WP_000080791.1.89927 WP_000080791.1.89977 WP_000080791.1.89988 WP_000080791.1.90017 WP_000080791.1.90050 WP_000080791.1.90063 WP_000080791.1.90078 WP_000080791.1.9009 WP_000080791.1.90139 WP_000080791.1.90168 WP_000080791.1.90171 WP_000080791.1.902 WP_000080791.1.90219 WP_000080791.1.90256 WP_000080791.1.90257 WP_000080791.1.90270 WP_000080791.1.90332 WP_000080791.1.90342 WP_000080791.1.90346 WP_000080791.1.90349 WP_000080791.1.90357 WP_000080791.1.90358 WP_000080791.1.9036 WP_000080791.1.9037 WP_000080791.1.90441 WP_000080791.1.90449 WP_000080791.1.90511 WP_000080791.1.90520 WP_000080791.1.90525 WP_000080791.1.90536 WP_000080791.1.90542 WP_000080791.1.90547 WP_000080791.1.9059 WP_000080791.1.90591 WP_000080791.1.90602 WP_000080791.1.90626 WP_000080791.1.90775 WP_000080791.1.90799 WP_000080791.1.9081 WP_000080791.1.90813 WP_000080791.1.90828 WP_000080791.1.90839 WP_000080791.1.90844 WP_000080791.1.90848 WP_000080791.1.90856 WP_000080791.1.90864 WP_000080791.1.90865 WP_000080791.1.9087 WP_000080791.1.90873 WP_000080791.1.90890 WP_000080791.1.909 WP_000080791.1.90905 WP_000080791.1.90951 WP_000080791.1.90967 WP_000080791.1.90979 WP_000080791.1.90988 WP_000080791.1.90996 WP_000080791.1.90997 WP_000080791.1.91 WP_000080791.1.91010 WP_000080791.1.91018 WP_000080791.1.9104 WP_000080791.1.91072 WP_000080791.1.91088 WP_000080791.1.91113 WP_000080791.1.91121 WP_000080791.1.91143 WP_000080791.1.91153 WP_000080791.1.91170 WP_000080791.1.91182 WP_000080791.1.9119 WP_000080791.1.91213 WP_000080791.1.91220 WP_000080791.1.91266 WP_000080791.1.91277 WP_000080791.1.91288 WP_000080791.1.91290 WP_000080791.1.91340 WP_000080791.1.91341 WP_000080791.1.91354 WP_000080791.1.91356 WP_000080791.1.91384 WP_000080791.1.91397 WP_000080791.1.91445 WP_000080791.1.91462 WP_000080791.1.91482 WP_000080791.1.91485 WP_000080791.1.915 WP_000080791.1.91511 WP_000080791.1.91515 WP_000080791.1.91516 WP_000080791.1.91548 WP_000080791.1.91551 WP_000080791.1.91566 WP_000080791.1.9157 WP_000080791.1.91596 WP_000080791.1.91626 WP_000080791.1.91640 WP_000080791.1.91643 WP_000080791.1.91651 WP_000080791.1.91666 WP_000080791.1.91672 WP_000080791.1.9168 WP_000080791.1.91685 WP_000080791.1.9169 WP_000080791.1.91739 WP_000080791.1.91756 WP_000080791.1.91782 WP_000080791.1.91801 WP_000080791.1.91843 WP_000080791.1.91850 WP_000080791.1.91871 WP_000080791.1.91879 WP_000080791.1.91887 WP_000080791.1.91893 WP_000080791.1.91954 WP_000080791.1.91959 WP_000080791.1.91965 WP_000080791.1.91971 WP_000080791.1.9199 WP_000080791.1.91994 WP_000080791.1.92005 WP_000080791.1.92014 WP_000080791.1.92019 WP_000080791.1.92025 WP_000080791.1.92031 WP_000080791.1.92048 WP_000080791.1.9209 WP_000080791.1.92096 WP_000080791.1.921 WP_000080791.1.92102 WP_000080791.1.92114 WP_000080791.1.9215 WP_000080791.1.92161 WP_000080791.1.92180 WP_000080791.1.92201 WP_000080791.1.92276 WP_000080791.1.92304 WP_000080791.1.92305 WP_000080791.1.92311 WP_000080791.1.92323 WP_000080791.1.92361 WP_000080791.1.92384 WP_000080791.1.92403 WP_000080791.1.92434 WP_000080791.1.92473 WP_000080791.1.92496 WP_000080791.1.9255 WP_000080791.1.92568 WP_000080791.1.92577 WP_000080791.1.92614 WP_000080791.1.92615 WP_000080791.1.92634 WP_000080791.1.92638 WP_000080791.1.9264 WP_000080791.1.92648 WP_000080791.1.9266 WP_000080791.1.92693 WP_000080791.1.92708 WP_000080791.1.92742 WP_000080791.1.92750 WP_000080791.1.92767 WP_000080791.1.92780 WP_000080791.1.92781 WP_000080791.1.92792 WP_000080791.1.92819 WP_000080791.1.92845 WP_000080791.1.92865 WP_000080791.1.92943 WP_000080791.1.92989 WP_000080791.1.93016 WP_000080791.1.93017 WP_000080791.1.93019 WP_000080791.1.93027 WP_000080791.1.93033 WP_000080791.1.93048 WP_000080791.1.93054 WP_000080791.1.93069 WP_000080791.1.93072 WP_000080791.1.93100 WP_000080791.1.93138 WP_000080791.1.93139 WP_000080791.1.93150 WP_000080791.1.93175 WP_000080791.1.93185 WP_000080791.1.93276 WP_000080791.1.93291 WP_000080791.1.93309 WP_000080791.1.93312 WP_000080791.1.93326 WP_000080791.1.93338 WP_000080791.1.93379 WP_000080791.1.93388 WP_000080791.1.934 WP_000080791.1.93428 WP_000080791.1.93431 WP_000080791.1.93461 WP_000080791.1.93464 WP_000080791.1.93509 WP_000080791.1.93533 WP_000080791.1.93601 WP_000080791.1.93629 WP_000080791.1.93630 WP_000080791.1.93634 WP_000080791.1.93639 WP_000080791.1.93652 WP_000080791.1.93670 WP_000080791.1.93673 WP_000080791.1.93679 WP_000080791.1.93694 WP_000080791.1.93695 WP_000080791.1.93716 WP_000080791.1.93737 WP_000080791.1.93743 WP_000080791.1.93755 WP_000080791.1.93765 WP_000080791.1.93768 WP_000080791.1.93821 WP_000080791.1.93873 WP_000080791.1.93877 WP_000080791.1.93911 WP_000080791.1.93918 WP_000080791.1.93922 WP_000080791.1.93939 WP_000080791.1.93971 WP_000080791.1.94008 WP_000080791.1.94025 WP_000080791.1.94028 WP_000080791.1.94035 WP_000080791.1.94040 WP_000080791.1.94057 WP_000080791.1.94069 WP_000080791.1.94156 WP_000080791.1.94176 WP_000080791.1.94187 WP_000080791.1.9420 WP_000080791.1.94213 WP_000080791.1.94232 WP_000080791.1.9426 WP_000080791.1.94271 WP_000080791.1.94282 WP_000080791.1.94298 WP_000080791.1.94302 WP_000080791.1.94317 WP_000080791.1.94343 WP_000080791.1.94353 WP_000080791.1.94367 WP_000080791.1.94388 WP_000080791.1.94404 WP_000080791.1.94417 WP_000080791.1.94430 WP_000080791.1.94436 WP_000080791.1.94438 WP_000080791.1.94445 WP_000080791.1.94446 WP_000080791.1.94468 WP_000080791.1.94507 WP_000080791.1.94542 WP_000080791.1.9457 WP_000080791.1.94589 WP_000080791.1.94619 WP_000080791.1.94626 WP_000080791.1.94653 WP_000080791.1.94676 WP_000080791.1.94686 WP_000080791.1.94692 WP_000080791.1.94695 WP_000080791.1.94704 WP_000080791.1.94738 WP_000080791.1.94739 WP_000080791.1.9474 WP_000080791.1.94754 WP_000080791.1.94790 WP_000080791.1.948 WP_000080791.1.94808 WP_000080791.1.94822 WP_000080791.1.94836 WP_000080791.1.94847 WP_000080791.1.94869 WP_000080791.1.94889 WP_000080791.1.9489 WP_000080791.1.94892 WP_000080791.1.94898 WP_000080791.1.9491 WP_000080791.1.94934 WP_000080791.1.94935 WP_000080791.1.94938 WP_000080791.1.94949 WP_000080791.1.94955 WP_000080791.1.94991 WP_000080791.1.94993 WP_000080791.1.94997 WP_000080791.1.95005 WP_000080791.1.95028 WP_000080791.1.95037 WP_000080791.1.95062 WP_000080791.1.95080 WP_000080791.1.95084 WP_000080791.1.95105 WP_000080791.1.95129 WP_000080791.1.9513 WP_000080791.1.95161 WP_000080791.1.95243 WP_000080791.1.95244 WP_000080791.1.95310 WP_000080791.1.95329 WP_000080791.1.95332 WP_000080791.1.95364 WP_000080791.1.95366 WP_000080791.1.95368 WP_000080791.1.95378 WP_000080791.1.95381 WP_000080791.1.95390 WP_000080791.1.95395 WP_000080791.1.95398 WP_000080791.1.95400 WP_000080791.1.95424 WP_000080791.1.95428 WP_000080791.1.95490 WP_000080791.1.95518 WP_000080791.1.95521 WP_000080791.1.95563 WP_000080791.1.9559 WP_000080791.1.95595 WP_000080791.1.95604 WP_000080791.1.95628 WP_000080791.1.95634 WP_000080791.1.95655 WP_000080791.1.9566 WP_000080791.1.95666 WP_000080791.1.95680 WP_000080791.1.95771 WP_000080791.1.95783 WP_000080791.1.95800 WP_000080791.1.95824 WP_000080791.1.95827 WP_000080791.1.95834 WP_000080791.1.95846 WP_000080791.1.95849 WP_000080791.1.95858 WP_000080791.1.95861 WP_000080791.1.95869 WP_000080791.1.95916 WP_000080791.1.95919 WP_000080791.1.95929 WP_000080791.1.95931 WP_000080791.1.95932 WP_000080791.1.95951 WP_000080791.1.96053 WP_000080791.1.96059 WP_000080791.1.96066 WP_000080791.1.96086 WP_000080791.1.96097 WP_000080791.1.96110 WP_000080791.1.96114 WP_000080791.1.96143 WP_000080791.1.96145 WP_000080791.1.9616 WP_000080791.1.96177 WP_000080791.1.96215 WP_000080791.1.96222 WP_000080791.1.96223 WP_000080791.1.96247 WP_000080791.1.96253 WP_000080791.1.96278 WP_000080791.1.96279 WP_000080791.1.96290 WP_000080791.1.96299 WP_000080791.1.96303 WP_000080791.1.9631 WP_000080791.1.96339 WP_000080791.1.96341 WP_000080791.1.96378 WP_000080791.1.96392 WP_000080791.1.96394 WP_000080791.1.9641 WP_000080791.1.96417 WP_000080791.1.96425 WP_000080791.1.96450 WP_000080791.1.96457 WP_000080791.1.96478 WP_000080791.1.96479 WP_000080791.1.96480 WP_000080791.1.9649 WP_000080791.1.96494 WP_000080791.1.965 WP_000080791.1.96558 WP_000080791.1.96585 WP_000080791.1.96609 WP_000080791.1.9661 WP_000080791.1.96617 WP_000080791.1.96633 WP_000080791.1.96650 WP_000080791.1.96676 WP_000080791.1.9668 WP_000080791.1.96695 WP_000080791.1.9671 WP_000080791.1.96725 WP_000080791.1.96759 WP_000080791.1.96762 WP_000080791.1.96796 WP_000080791.1.96797 WP_000080791.1.96817 WP_000080791.1.9682 WP_000080791.1.96894 WP_000080791.1.9690 WP_000080791.1.96907 WP_000080791.1.9691 WP_000080791.1.96924 WP_000080791.1.96936 WP_000080791.1.96944 WP_000080791.1.96971 WP_000080791.1.96984 WP_000080791.1.97011 WP_000080791.1.97049 WP_000080791.1.97119 WP_000080791.1.97123 WP_000080791.1.97147 WP_000080791.1.97160 WP_000080791.1.97193 WP_000080791.1.97200 WP_000080791.1.97226 WP_000080791.1.9723 WP_000080791.1.97247 WP_000080791.1.97248 WP_000080791.1.97269 WP_000080791.1.97282 WP_000080791.1.9729 WP_000080791.1.97292 WP_000080791.1.97344 WP_000080791.1.97356 WP_000080791.1.97361 WP_000080791.1.97379 WP_000080791.1.97387 WP_000080791.1.9740 WP_000080791.1.97402 WP_000080791.1.97418 WP_000080791.1.97421 WP_000080791.1.97434 WP_000080791.1.97437 WP_000080791.1.97439 WP_000080791.1.97459 WP_000080791.1.97464 WP_000080791.1.9747 WP_000080791.1.97502 WP_000080791.1.97513 WP_000080791.1.97525 WP_000080791.1.97544 WP_000080791.1.97560 WP_000080791.1.97571 WP_000080791.1.97654 WP_000080791.1.97667 WP_000080791.1.97677 WP_000080791.1.97685 WP_000080791.1.9770 WP_000080791.1.97705 WP_000080791.1.97770 WP_000080791.1.97778 WP_000080791.1.97789 WP_000080791.1.978 WP_000080791.1.97822 WP_000080791.1.97825 WP_000080791.1.97871 WP_000080791.1.97930 WP_000080791.1.97962 WP_000080791.1.97982 WP_000080791.1.97996 WP_000080791.1.98000 WP_000080791.1.98005 WP_000080791.1.98026 WP_000080791.1.9803 WP_000080791.1.98046 WP_000080791.1.98082 WP_000080791.1.98083 WP_000080791.1.981 WP_000080791.1.98102 WP_000080791.1.98155 WP_000080791.1.9816 WP_000080791.1.98176 WP_000080791.1.98205 WP_000080791.1.98220 WP_000080791.1.98232 WP_000080791.1.98235 WP_000080791.1.98239 WP_000080791.1.98241 WP_000080791.1.98244 WP_000080791.1.98251 WP_000080791.1.98279 WP_000080791.1.98292 WP_000080791.1.98294 WP_000080791.1.98301 WP_000080791.1.98312 WP_000080791.1.98355 WP_000080791.1.98357 WP_000080791.1.98384 WP_000080791.1.98424 WP_000080791.1.98429 WP_000080791.1.98442 WP_000080791.1.98451 WP_000080791.1.98466 WP_000080791.1.98477 WP_000080791.1.98480 WP_000080791.1.98484 WP_000080791.1.98543 WP_000080791.1.98549 WP_000080791.1.98569 WP_000080791.1.98578 WP_000080791.1.98626 WP_000080791.1.98628 WP_000080791.1.98633 WP_000080791.1.9864 WP_000080791.1.98654 WP_000080791.1.98702 WP_000080791.1.98727 WP_000080791.1.98775 WP_000080791.1.98776 WP_000080791.1.98784 WP_000080791.1.9883 WP_000080791.1.98875 WP_000080791.1.98920 WP_000080791.1.99046 WP_000080791.1.99060 WP_000080791.1.99101 WP_000080791.1.99182 WP_000080791.1.99234 WP_000080791.1.99246 WP_000080791.1.99289 WP_000080791.1.9930 WP_000080791.1.99304 WP_000080791.1.99306 WP_000080791.1.99307 WP_000080791.1.99310 WP_000080791.1.99319 WP_000080791.1.99334 WP_000080791.1.99345 WP_000080791.1.99349 WP_000080791.1.9935 WP_000080791.1.99361 WP_000080791.1.99366 WP_000080791.1.99392 WP_000080791.1.9940 WP_000080791.1.99401 WP_000080791.1.99453 WP_000080791.1.99458 WP_000080791.1.99471 WP_000080791.1.99472 WP_000080791.1.99475 WP_000080791.1.99487 WP_000080791.1.99498 WP_000080791.1.9950 WP_000080791.1.99501 WP_000080791.1.99511 WP_000080791.1.99534 WP_000080791.1.99549 WP_000080791.1.99571 WP_000080791.1.99592 WP_000080791.1.99602 WP_000080791.1.99603 WP_000080791.1.99632 WP_000080791.1.99666 WP_000080791.1.99692 WP_000080791.1.99694 WP_000080791.1.99698 WP_000080791.1.99734 WP_000080791.1.99782 WP_000080791.1.99804 WP_000080791.1.99827 WP_000080791.1.99869 WP_000080791.1.99874 WP_000080791.1.99892 WP_000080791.1.99929 WP_000080791.1.99986 YP_002409041.1.10275 YP_006781536.1.12065 gi|254795882|ref|YP_003080719.1| gi|15834065|ref|NP_312838.1| gi|387614578|ref|YP_006117694.1| gi|251787152|ref|YP_003001456.1| gi|387885110|ref|YP_006315412.1| gi|218556448|ref|YP_002389362.1| gi|222158596|ref|YP_002558735.1| gi|410484932|ref|YP_006772478.1| gi|386616711|ref|YP_006136377.1| gi|218697600|ref|YP_002405267.1| gi|260870604|ref|YP_003237006.1| gi|556553724|ref|YP_008724254.1| gi|386636772|ref|YP_006156491.1| gi|110644226|ref|YP_671956.1| gi|386641537|ref|YP_006108335.1| gi|218701412|ref|YP_002409041.1| gi|251787152|ref|YP_003001456.1| gi|209398236|ref|YP_002273405.1| gi|387831792|ref|YP_003351729.1| gi|170083360|ref|YP_001732680.1| gi|238902955|ref|YP_002928751.1| gi|291285299|ref|YP_003502117.1| gi|386631852|ref|YP_006151572.1| gi|91213429|ref|YP_543415.1| gi|387509332|ref|YP_006161588.1| 199310.c4835 300268.SBO_3902 316385.ECDH10B_4078 316407.yiiD 362663.ECP_4097 364106.UTI89_C4472 386585.ECs4811 405955.APECO1_2579 444450.ECH74115_5335 511145.b3888 544404.ECSP_4944 573235.ECO26_4702 585034.ECIAI1_4088 585035.ECS88_4333 585054.EFER_3891 585055.EC55989_4362 585057.ECIAI39_3112 585396.ECO111_4708 595496.BWG_3558 gi|407466888|ref|YP_006786670.1| gi|16131728|ref|NP_418324.1| gi|407484386|ref|YP_006781536.1| gi|386707143|ref|YP_006170990.1| gi|26250650|ref|NP_756690.1| gi|388479370|ref|YP_491562.1| gi|117626156|ref|YP_859479.1| gi|471335375|ref|YP_007558852.1| gi|544392305|ref|YP_008567055.1| APC259 ET32 NYSGXRC-6262i YIID_ECOLI gi|260857714|ref|YP_003231605.1| gi|218551130|ref|YP_002384921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]