SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38704250|ref|NP_313260.2| from Escherichia coli O157:H7 str. Sakai

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38704250|ref|NP_313260.2|
Domain Number 1 Region: 10-166
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.97e-31
Family N-acetyl transferase, NAT 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38704250|ref|NP_313260.2|
Sequence length 167
Comment hypothetical protein ECs5233 [Escherichia coli O157:H7 str. Sakai]
Sequence
MNNIAPQSPVMRRLTLQDNPAIARVIRQVSAEYGLTADKGYTVADPNLDELYQVYSQPGH
AYWVVEYEGEVVGGGGIAPLAGSESDICELQKMYFLPAIRGKGLAKKLALKAMEEAREMG
FKRCYLETTAFLKEAIGLYEHLGFQHIDYALGCTGHVDCEVRMLREL
Download sequence
Identical sequences A0A023Z7B3 A0A024L6Z8 A0A025CLA0 A0A0F6CCL1 A0A0F6FG69 A0A0H3PW09 A0A140NBR1 A0A142GYF3 A0A1X3L885 A0A1Z3UWK8 A0A2H1BS88 D3QLH3 F4TNK6 L3BWR4 L4UVG6 Q7X4V9 S0WZL9 S0YMQ3 T6LJI0 U9XNL6 W1B5Q9
gi|251787503|ref|YP_003001807.1| gi|251787503|ref|YP_003001807.1| gi|387509712|ref|YP_006161968.1| gi|291285668|ref|YP_003502486.1| NP_313260.2.58667 WP_001059397.1.10001 WP_001059397.1.100073 WP_001059397.1.10010 WP_001059397.1.100299 WP_001059397.1.100302 WP_001059397.1.100508 WP_001059397.1.100554 WP_001059397.1.100803 WP_001059397.1.100916 WP_001059397.1.100925 WP_001059397.1.101105 WP_001059397.1.101166 WP_001059397.1.101186 WP_001059397.1.101206 WP_001059397.1.101628 WP_001059397.1.10206 WP_001059397.1.102094 WP_001059397.1.102139 WP_001059397.1.10273 WP_001059397.1.10335 WP_001059397.1.10476 WP_001059397.1.10491 WP_001059397.1.10524 WP_001059397.1.10569 WP_001059397.1.10761 WP_001059397.1.10824 WP_001059397.1.10970 WP_001059397.1.11052 WP_001059397.1.1111 WP_001059397.1.11240 WP_001059397.1.11265 WP_001059397.1.11301 WP_001059397.1.11420 WP_001059397.1.11542 WP_001059397.1.11671 WP_001059397.1.11690 WP_001059397.1.12259 WP_001059397.1.12305 WP_001059397.1.12352 WP_001059397.1.12459 WP_001059397.1.12552 WP_001059397.1.12558 WP_001059397.1.12766 WP_001059397.1.13002 WP_001059397.1.13060 WP_001059397.1.1312 WP_001059397.1.13217 WP_001059397.1.13223 WP_001059397.1.13332 WP_001059397.1.13348 WP_001059397.1.13430 WP_001059397.1.13442 WP_001059397.1.13481 WP_001059397.1.13601 WP_001059397.1.13881 WP_001059397.1.13936 WP_001059397.1.13939 WP_001059397.1.14110 WP_001059397.1.1438 WP_001059397.1.14453 WP_001059397.1.14621 WP_001059397.1.14687 WP_001059397.1.14748 WP_001059397.1.14871 WP_001059397.1.14914 WP_001059397.1.15356 WP_001059397.1.15453 WP_001059397.1.15503 WP_001059397.1.15527 WP_001059397.1.1559 WP_001059397.1.15626 WP_001059397.1.15702 WP_001059397.1.15782 WP_001059397.1.16075 WP_001059397.1.1609 WP_001059397.1.16133 WP_001059397.1.16222 WP_001059397.1.16270 WP_001059397.1.16272 WP_001059397.1.16463 WP_001059397.1.16481 WP_001059397.1.16715 WP_001059397.1.16845 WP_001059397.1.17061 WP_001059397.1.17084 WP_001059397.1.17187 WP_001059397.1.1731 WP_001059397.1.17386 WP_001059397.1.17415 WP_001059397.1.17496 WP_001059397.1.17515 WP_001059397.1.17568 WP_001059397.1.17757 WP_001059397.1.17904 WP_001059397.1.17937 WP_001059397.1.18064 WP_001059397.1.18112 WP_001059397.1.18121 WP_001059397.1.18136 WP_001059397.1.18326 WP_001059397.1.1834 WP_001059397.1.18340 WP_001059397.1.1881 WP_001059397.1.18837 WP_001059397.1.18995 WP_001059397.1.19039 WP_001059397.1.191 WP_001059397.1.19140 WP_001059397.1.19350 WP_001059397.1.19419 WP_001059397.1.19649 WP_001059397.1.19661 WP_001059397.1.1982 WP_001059397.1.19840 WP_001059397.1.19847 WP_001059397.1.2005 WP_001059397.1.20264 WP_001059397.1.20449 WP_001059397.1.20480 WP_001059397.1.20546 WP_001059397.1.20594 WP_001059397.1.20609 WP_001059397.1.20737 WP_001059397.1.20745 WP_001059397.1.2075 WP_001059397.1.20893 WP_001059397.1.20941 WP_001059397.1.20950 WP_001059397.1.20989 WP_001059397.1.2100 WP_001059397.1.21450 WP_001059397.1.21508 WP_001059397.1.21666 WP_001059397.1.21668 WP_001059397.1.21756 WP_001059397.1.21962 WP_001059397.1.22060 WP_001059397.1.2218 WP_001059397.1.22251 WP_001059397.1.22304 WP_001059397.1.22381 WP_001059397.1.22594 WP_001059397.1.22743 WP_001059397.1.22759 WP_001059397.1.22885 WP_001059397.1.22925 WP_001059397.1.23044 WP_001059397.1.23073 WP_001059397.1.23115 WP_001059397.1.23241 WP_001059397.1.23299 WP_001059397.1.23323 WP_001059397.1.23355 WP_001059397.1.23467 WP_001059397.1.23790 WP_001059397.1.23806 WP_001059397.1.23812 WP_001059397.1.23838 WP_001059397.1.23855 WP_001059397.1.2388 WP_001059397.1.23895 WP_001059397.1.23899 WP_001059397.1.23973 WP_001059397.1.23984 WP_001059397.1.24070 WP_001059397.1.24283 WP_001059397.1.24316 WP_001059397.1.24341 WP_001059397.1.24362 WP_001059397.1.24753 WP_001059397.1.24870 WP_001059397.1.24968 WP_001059397.1.25076 WP_001059397.1.25082 WP_001059397.1.25088 WP_001059397.1.25201 WP_001059397.1.25203 WP_001059397.1.25305 WP_001059397.1.25312 WP_001059397.1.25526 WP_001059397.1.25577 WP_001059397.1.25794 WP_001059397.1.25819 WP_001059397.1.25831 WP_001059397.1.26066 WP_001059397.1.26105 WP_001059397.1.26121 WP_001059397.1.26134 WP_001059397.1.26246 WP_001059397.1.26438 WP_001059397.1.26474 WP_001059397.1.26525 WP_001059397.1.26590 WP_001059397.1.26761 WP_001059397.1.26878 WP_001059397.1.26975 WP_001059397.1.26998 WP_001059397.1.27338 WP_001059397.1.27445 WP_001059397.1.27691 WP_001059397.1.27797 WP_001059397.1.28110 WP_001059397.1.28143 WP_001059397.1.28318 WP_001059397.1.28551 WP_001059397.1.28734 WP_001059397.1.28879 WP_001059397.1.28919 WP_001059397.1.29049 WP_001059397.1.291 WP_001059397.1.29126 WP_001059397.1.29394 WP_001059397.1.29404 WP_001059397.1.29564 WP_001059397.1.29597 WP_001059397.1.29618 WP_001059397.1.2978 WP_001059397.1.29818 WP_001059397.1.29976 WP_001059397.1.30 WP_001059397.1.30019 WP_001059397.1.30052 WP_001059397.1.30064 WP_001059397.1.30164 WP_001059397.1.30476 WP_001059397.1.30637 WP_001059397.1.30808 WP_001059397.1.30843 WP_001059397.1.30918 WP_001059397.1.30993 WP_001059397.1.30999 WP_001059397.1.31055 WP_001059397.1.31149 WP_001059397.1.312 WP_001059397.1.31252 WP_001059397.1.3140 WP_001059397.1.31401 WP_001059397.1.31506 WP_001059397.1.31575 WP_001059397.1.31715 WP_001059397.1.31956 WP_001059397.1.32063 WP_001059397.1.322 WP_001059397.1.32243 WP_001059397.1.3233 WP_001059397.1.32536 WP_001059397.1.32574 WP_001059397.1.32590 WP_001059397.1.32772 WP_001059397.1.32888 WP_001059397.1.32931 WP_001059397.1.3295 WP_001059397.1.33049 WP_001059397.1.33055 WP_001059397.1.33094 WP_001059397.1.33125 WP_001059397.1.33146 WP_001059397.1.33167 WP_001059397.1.33178 WP_001059397.1.33268 WP_001059397.1.33476 WP_001059397.1.33981 WP_001059397.1.34204 WP_001059397.1.34224 WP_001059397.1.34269 WP_001059397.1.34383 WP_001059397.1.3439 WP_001059397.1.34500 WP_001059397.1.34532 WP_001059397.1.34680 WP_001059397.1.34682 WP_001059397.1.34686 WP_001059397.1.3515 WP_001059397.1.35360 WP_001059397.1.35393 WP_001059397.1.3550 WP_001059397.1.35704 WP_001059397.1.36010 WP_001059397.1.36207 WP_001059397.1.36212 WP_001059397.1.36626 WP_001059397.1.3668 WP_001059397.1.36739 WP_001059397.1.36767 WP_001059397.1.37102 WP_001059397.1.37122 WP_001059397.1.37337 WP_001059397.1.37372 WP_001059397.1.37485 WP_001059397.1.37548 WP_001059397.1.3762 WP_001059397.1.37731 WP_001059397.1.37766 WP_001059397.1.37769 WP_001059397.1.3795 WP_001059397.1.38043 WP_001059397.1.38050 WP_001059397.1.38063 WP_001059397.1.38107 WP_001059397.1.3822 WP_001059397.1.38306 WP_001059397.1.38369 WP_001059397.1.38751 WP_001059397.1.38835 WP_001059397.1.389 WP_001059397.1.38958 WP_001059397.1.39167 WP_001059397.1.39180 WP_001059397.1.39268 WP_001059397.1.39310 WP_001059397.1.39415 WP_001059397.1.39564 WP_001059397.1.39601 WP_001059397.1.39646 WP_001059397.1.39820 WP_001059397.1.40113 WP_001059397.1.40234 WP_001059397.1.4030 WP_001059397.1.40549 WP_001059397.1.40629 WP_001059397.1.40742 WP_001059397.1.40758 WP_001059397.1.40793 WP_001059397.1.40882 WP_001059397.1.40900 WP_001059397.1.40952 WP_001059397.1.4103 WP_001059397.1.41060 WP_001059397.1.41294 WP_001059397.1.41330 WP_001059397.1.41401 WP_001059397.1.41478 WP_001059397.1.41488 WP_001059397.1.41536 WP_001059397.1.4158 WP_001059397.1.41734 WP_001059397.1.41849 WP_001059397.1.42036 WP_001059397.1.4213 WP_001059397.1.4242 WP_001059397.1.42447 WP_001059397.1.4250 WP_001059397.1.42513 WP_001059397.1.42594 WP_001059397.1.4261 WP_001059397.1.42863 WP_001059397.1.42879 WP_001059397.1.42975 WP_001059397.1.43013 WP_001059397.1.43079 WP_001059397.1.43121 WP_001059397.1.4313 WP_001059397.1.43140 WP_001059397.1.43196 WP_001059397.1.43384 WP_001059397.1.43448 WP_001059397.1.43469 WP_001059397.1.43536 WP_001059397.1.43604 WP_001059397.1.43738 WP_001059397.1.43754 WP_001059397.1.43769 WP_001059397.1.43798 WP_001059397.1.43816 WP_001059397.1.43837 WP_001059397.1.43898 WP_001059397.1.43911 WP_001059397.1.43939 WP_001059397.1.44125 WP_001059397.1.44165 WP_001059397.1.44203 WP_001059397.1.44324 WP_001059397.1.44389 WP_001059397.1.44488 WP_001059397.1.44561 WP_001059397.1.44733 WP_001059397.1.44906 WP_001059397.1.44923 WP_001059397.1.44954 WP_001059397.1.45020 WP_001059397.1.45076 WP_001059397.1.45153 WP_001059397.1.45195 WP_001059397.1.45293 WP_001059397.1.45404 WP_001059397.1.45565 WP_001059397.1.45575 WP_001059397.1.45707 WP_001059397.1.45740 WP_001059397.1.45841 WP_001059397.1.45901 WP_001059397.1.45941 WP_001059397.1.46039 WP_001059397.1.4619 WP_001059397.1.46282 WP_001059397.1.46283 WP_001059397.1.46369 WP_001059397.1.46414 WP_001059397.1.46451 WP_001059397.1.4647 WP_001059397.1.46503 WP_001059397.1.46597 WP_001059397.1.46611 WP_001059397.1.46626 WP_001059397.1.46810 WP_001059397.1.46832 WP_001059397.1.46913 WP_001059397.1.4708 WP_001059397.1.47140 WP_001059397.1.47167 WP_001059397.1.47197 WP_001059397.1.47224 WP_001059397.1.4723 WP_001059397.1.47411 WP_001059397.1.47784 WP_001059397.1.47827 WP_001059397.1.47884 WP_001059397.1.47954 WP_001059397.1.47994 WP_001059397.1.48065 WP_001059397.1.48090 WP_001059397.1.48111 WP_001059397.1.4812 WP_001059397.1.48226 WP_001059397.1.48258 WP_001059397.1.48697 WP_001059397.1.4871 WP_001059397.1.48712 WP_001059397.1.48792 WP_001059397.1.48806 WP_001059397.1.48847 WP_001059397.1.49275 WP_001059397.1.4931 WP_001059397.1.49332 WP_001059397.1.49401 WP_001059397.1.49464 WP_001059397.1.49496 WP_001059397.1.49567 WP_001059397.1.49655 WP_001059397.1.49771 WP_001059397.1.49987 WP_001059397.1.5003 WP_001059397.1.50036 WP_001059397.1.50110 WP_001059397.1.50345 WP_001059397.1.50358 WP_001059397.1.50361 WP_001059397.1.5037 WP_001059397.1.50380 WP_001059397.1.50452 WP_001059397.1.50549 WP_001059397.1.50762 WP_001059397.1.50986 WP_001059397.1.51154 WP_001059397.1.51171 WP_001059397.1.51505 WP_001059397.1.51643 WP_001059397.1.51693 WP_001059397.1.51834 WP_001059397.1.52039 WP_001059397.1.5217 WP_001059397.1.52421 WP_001059397.1.52496 WP_001059397.1.52543 WP_001059397.1.52883 WP_001059397.1.52933 WP_001059397.1.52945 WP_001059397.1.53084 WP_001059397.1.53181 WP_001059397.1.53211 WP_001059397.1.53252 WP_001059397.1.53270 WP_001059397.1.54024 WP_001059397.1.54213 WP_001059397.1.5441 WP_001059397.1.54454 WP_001059397.1.54476 WP_001059397.1.5467 WP_001059397.1.54760 WP_001059397.1.5486 WP_001059397.1.54883 WP_001059397.1.54927 WP_001059397.1.54981 WP_001059397.1.55218 WP_001059397.1.55275 WP_001059397.1.55286 WP_001059397.1.55374 WP_001059397.1.55492 WP_001059397.1.55820 WP_001059397.1.55838 WP_001059397.1.55892 WP_001059397.1.55897 WP_001059397.1.56072 WP_001059397.1.56151 WP_001059397.1.56285 WP_001059397.1.5639 WP_001059397.1.56392 WP_001059397.1.56481 WP_001059397.1.56489 WP_001059397.1.56491 WP_001059397.1.56554 WP_001059397.1.56571 WP_001059397.1.57032 WP_001059397.1.57068 WP_001059397.1.57071 WP_001059397.1.57086 WP_001059397.1.57180 WP_001059397.1.57197 WP_001059397.1.57280 WP_001059397.1.57453 WP_001059397.1.57466 WP_001059397.1.57610 WP_001059397.1.5764 WP_001059397.1.57646 WP_001059397.1.57836 WP_001059397.1.57846 WP_001059397.1.58048 WP_001059397.1.58057 WP_001059397.1.58169 WP_001059397.1.58238 WP_001059397.1.584 WP_001059397.1.58423 WP_001059397.1.58493 WP_001059397.1.5852 WP_001059397.1.58707 WP_001059397.1.58723 WP_001059397.1.59038 WP_001059397.1.59263 WP_001059397.1.59359 WP_001059397.1.59374 WP_001059397.1.59470 WP_001059397.1.59491 WP_001059397.1.59679 WP_001059397.1.59733 WP_001059397.1.59838 WP_001059397.1.59858 WP_001059397.1.59905 WP_001059397.1.59931 WP_001059397.1.59959 WP_001059397.1.60042 WP_001059397.1.60043 WP_001059397.1.60117 WP_001059397.1.6013 WP_001059397.1.60304 WP_001059397.1.60374 WP_001059397.1.60461 WP_001059397.1.60498 WP_001059397.1.60505 WP_001059397.1.60613 WP_001059397.1.60647 WP_001059397.1.60744 WP_001059397.1.60761 WP_001059397.1.60872 WP_001059397.1.60935 WP_001059397.1.61039 WP_001059397.1.61046 WP_001059397.1.61097 WP_001059397.1.61099 WP_001059397.1.61108 WP_001059397.1.61186 WP_001059397.1.61253 WP_001059397.1.61623 WP_001059397.1.61663 WP_001059397.1.61772 WP_001059397.1.618 WP_001059397.1.61874 WP_001059397.1.62135 WP_001059397.1.62182 WP_001059397.1.62480 WP_001059397.1.62481 WP_001059397.1.6261 WP_001059397.1.62675 WP_001059397.1.62843 WP_001059397.1.62888 WP_001059397.1.6331 WP_001059397.1.63445 WP_001059397.1.63563 WP_001059397.1.63586 WP_001059397.1.63615 WP_001059397.1.6364 WP_001059397.1.63872 WP_001059397.1.63957 WP_001059397.1.64086 WP_001059397.1.64138 WP_001059397.1.64161 WP_001059397.1.6431 WP_001059397.1.64355 WP_001059397.1.64371 WP_001059397.1.6445 WP_001059397.1.64621 WP_001059397.1.64657 WP_001059397.1.64946 WP_001059397.1.64990 WP_001059397.1.65035 WP_001059397.1.65084 WP_001059397.1.6511 WP_001059397.1.65118 WP_001059397.1.65151 WP_001059397.1.65194 WP_001059397.1.65372 WP_001059397.1.65546 WP_001059397.1.6587 WP_001059397.1.65875 WP_001059397.1.65898 WP_001059397.1.65963 WP_001059397.1.65978 WP_001059397.1.65988 WP_001059397.1.66033 WP_001059397.1.66100 WP_001059397.1.66280 WP_001059397.1.66531 WP_001059397.1.66566 WP_001059397.1.66796 WP_001059397.1.66873 WP_001059397.1.66922 WP_001059397.1.66933 WP_001059397.1.6706 WP_001059397.1.67073 WP_001059397.1.67136 WP_001059397.1.67150 WP_001059397.1.67158 WP_001059397.1.67200 WP_001059397.1.67210 WP_001059397.1.67214 WP_001059397.1.67446 WP_001059397.1.67451 WP_001059397.1.67533 WP_001059397.1.67676 WP_001059397.1.6769 WP_001059397.1.67726 WP_001059397.1.67753 WP_001059397.1.67775 WP_001059397.1.67780 WP_001059397.1.6793 WP_001059397.1.68012 WP_001059397.1.68070 WP_001059397.1.68079 WP_001059397.1.68096 WP_001059397.1.68138 WP_001059397.1.68411 WP_001059397.1.68493 WP_001059397.1.68523 WP_001059397.1.68751 WP_001059397.1.6880 WP_001059397.1.6887 WP_001059397.1.68936 WP_001059397.1.69054 WP_001059397.1.6921 WP_001059397.1.69247 WP_001059397.1.69350 WP_001059397.1.69351 WP_001059397.1.6945 WP_001059397.1.69569 WP_001059397.1.69780 WP_001059397.1.69810 WP_001059397.1.69818 WP_001059397.1.69872 WP_001059397.1.69896 WP_001059397.1.70123 WP_001059397.1.70125 WP_001059397.1.70200 WP_001059397.1.70517 WP_001059397.1.70539 WP_001059397.1.70576 WP_001059397.1.70705 WP_001059397.1.70713 WP_001059397.1.70723 WP_001059397.1.70787 WP_001059397.1.71003 WP_001059397.1.7102 WP_001059397.1.71099 WP_001059397.1.71205 WP_001059397.1.71225 WP_001059397.1.71226 WP_001059397.1.71269 WP_001059397.1.71423 WP_001059397.1.71448 WP_001059397.1.71632 WP_001059397.1.71695 WP_001059397.1.71840 WP_001059397.1.71940 WP_001059397.1.72016 WP_001059397.1.72090 WP_001059397.1.72180 WP_001059397.1.72322 WP_001059397.1.72427 WP_001059397.1.72614 WP_001059397.1.72641 WP_001059397.1.72694 WP_001059397.1.7291 WP_001059397.1.72913 WP_001059397.1.73061 WP_001059397.1.73126 WP_001059397.1.73230 WP_001059397.1.73343 WP_001059397.1.73604 WP_001059397.1.73626 WP_001059397.1.73785 WP_001059397.1.73801 WP_001059397.1.73882 WP_001059397.1.7392 WP_001059397.1.73934 WP_001059397.1.73968 WP_001059397.1.74251 WP_001059397.1.7429 WP_001059397.1.74367 WP_001059397.1.7446 WP_001059397.1.74521 WP_001059397.1.74536 WP_001059397.1.74557 WP_001059397.1.7475 WP_001059397.1.74828 WP_001059397.1.74880 WP_001059397.1.75030 WP_001059397.1.75164 WP_001059397.1.75248 WP_001059397.1.7536 WP_001059397.1.75382 WP_001059397.1.7539 WP_001059397.1.75507 WP_001059397.1.75536 WP_001059397.1.75577 WP_001059397.1.75694 WP_001059397.1.75767 WP_001059397.1.7583 WP_001059397.1.7597 WP_001059397.1.75989 WP_001059397.1.76054 WP_001059397.1.7608 WP_001059397.1.76152 WP_001059397.1.76390 WP_001059397.1.76407 WP_001059397.1.76448 WP_001059397.1.76477 WP_001059397.1.76697 WP_001059397.1.76815 WP_001059397.1.76827 WP_001059397.1.77099 WP_001059397.1.77128 WP_001059397.1.77239 WP_001059397.1.77275 WP_001059397.1.77392 WP_001059397.1.77632 WP_001059397.1.77644 WP_001059397.1.77657 WP_001059397.1.77707 WP_001059397.1.77760 WP_001059397.1.77961 WP_001059397.1.77979 WP_001059397.1.7799 WP_001059397.1.78063 WP_001059397.1.784 WP_001059397.1.7855 WP_001059397.1.78593 WP_001059397.1.78611 WP_001059397.1.78791 WP_001059397.1.7896 WP_001059397.1.79172 WP_001059397.1.79249 WP_001059397.1.79312 WP_001059397.1.7940 WP_001059397.1.7952 WP_001059397.1.79528 WP_001059397.1.79563 WP_001059397.1.79576 WP_001059397.1.79640 WP_001059397.1.79715 WP_001059397.1.79764 WP_001059397.1.79866 WP_001059397.1.79965 WP_001059397.1.80309 WP_001059397.1.80330 WP_001059397.1.80402 WP_001059397.1.80517 WP_001059397.1.80578 WP_001059397.1.80606 WP_001059397.1.81070 WP_001059397.1.81160 WP_001059397.1.81219 WP_001059397.1.81273 WP_001059397.1.81420 WP_001059397.1.81442 WP_001059397.1.81514 WP_001059397.1.81754 WP_001059397.1.81821 WP_001059397.1.81873 WP_001059397.1.81934 WP_001059397.1.81975 WP_001059397.1.82010 WP_001059397.1.82057 WP_001059397.1.82296 WP_001059397.1.82594 WP_001059397.1.82629 WP_001059397.1.8268 WP_001059397.1.82797 WP_001059397.1.82820 WP_001059397.1.83099 WP_001059397.1.83144 WP_001059397.1.83214 WP_001059397.1.83238 WP_001059397.1.8345 WP_001059397.1.83712 WP_001059397.1.8384 WP_001059397.1.84219 WP_001059397.1.84264 WP_001059397.1.84312 WP_001059397.1.84482 WP_001059397.1.84635 WP_001059397.1.84657 WP_001059397.1.8477 WP_001059397.1.84797 WP_001059397.1.84966 WP_001059397.1.85253 WP_001059397.1.85558 WP_001059397.1.85722 WP_001059397.1.85772 WP_001059397.1.86001 WP_001059397.1.86105 WP_001059397.1.86171 WP_001059397.1.86225 WP_001059397.1.86255 WP_001059397.1.86340 WP_001059397.1.86574 WP_001059397.1.86753 WP_001059397.1.86994 WP_001059397.1.87076 WP_001059397.1.87247 WP_001059397.1.87254 WP_001059397.1.87382 WP_001059397.1.87616 WP_001059397.1.88197 WP_001059397.1.8843 WP_001059397.1.88524 WP_001059397.1.88528 WP_001059397.1.8879 WP_001059397.1.88803 WP_001059397.1.88891 WP_001059397.1.89069 WP_001059397.1.89322 WP_001059397.1.89335 WP_001059397.1.89385 WP_001059397.1.89405 WP_001059397.1.89551 WP_001059397.1.89569 WP_001059397.1.89781 WP_001059397.1.89852 WP_001059397.1.89988 WP_001059397.1.90139 WP_001059397.1.90219 WP_001059397.1.90257 WP_001059397.1.90342 WP_001059397.1.90449 WP_001059397.1.90690 WP_001059397.1.90837 WP_001059397.1.90848 WP_001059397.1.90967 WP_001059397.1.9098 WP_001059397.1.90997 WP_001059397.1.91072 WP_001059397.1.91088 WP_001059397.1.91153 WP_001059397.1.91170 WP_001059397.1.91288 WP_001059397.1.91356 WP_001059397.1.91384 WP_001059397.1.91425 WP_001059397.1.91548 WP_001059397.1.91626 WP_001059397.1.91651 WP_001059397.1.9168 WP_001059397.1.91801 WP_001059397.1.91871 WP_001059397.1.91879 WP_001059397.1.92005 WP_001059397.1.92114 WP_001059397.1.92361 WP_001059397.1.92750 WP_001059397.1.92819 WP_001059397.1.93027 WP_001059397.1.93069 WP_001059397.1.93112 WP_001059397.1.9327 WP_001059397.1.93312 WP_001059397.1.93427 WP_001059397.1.93428 WP_001059397.1.93601 WP_001059397.1.93630 WP_001059397.1.93670 WP_001059397.1.93695 WP_001059397.1.93821 WP_001059397.1.94213 WP_001059397.1.9426 WP_001059397.1.94302 WP_001059397.1.94343 WP_001059397.1.94544 WP_001059397.1.94589 WP_001059397.1.94646 WP_001059397.1.94676 WP_001059397.1.94739 WP_001059397.1.94754 WP_001059397.1.94790 WP_001059397.1.948 WP_001059397.1.94991 WP_001059397.1.95011 WP_001059397.1.95028 WP_001059397.1.95035 WP_001059397.1.95129 WP_001059397.1.95275 WP_001059397.1.95332 WP_001059397.1.95834 WP_001059397.1.96059 WP_001059397.1.96086 WP_001059397.1.9616 WP_001059397.1.96425 WP_001059397.1.96450 WP_001059397.1.96480 WP_001059397.1.96609 WP_001059397.1.96725 WP_001059397.1.96796 WP_001059397.1.97193 WP_001059397.1.97231 WP_001059397.1.9729 WP_001059397.1.97351 WP_001059397.1.9740 WP_001059397.1.97402 WP_001059397.1.97459 WP_001059397.1.97513 WP_001059397.1.97632 WP_001059397.1.9770 WP_001059397.1.97789 WP_001059397.1.97871 WP_001059397.1.98000 WP_001059397.1.98046 WP_001059397.1.98083 WP_001059397.1.981 WP_001059397.1.98155 WP_001059397.1.98176 WP_001059397.1.98187 WP_001059397.1.98202 WP_001059397.1.98205 WP_001059397.1.98279 WP_001059397.1.98312 WP_001059397.1.98384 WP_001059397.1.98404 WP_001059397.1.98429 WP_001059397.1.98442 WP_001059397.1.98543 WP_001059397.1.98569 WP_001059397.1.9883 WP_001059397.1.98920 WP_001059397.1.99101 WP_001059397.1.99182 WP_001059397.1.99234 WP_001059397.1.99453 WP_001059397.1.99487 WP_001059397.1.99501 WP_001059397.1.99692 WP_001059397.1.99986 gi|38704250|ref|NP_313260.2| gi|254796276|ref|YP_003081113.1| gi|387885475|ref|YP_006315777.1| gi|254164181|ref|YP_003047291.1| 386585.ECs5233 413997.ECB_04122 444450.ECH74115_5777 469008.ECBD_3780 544404.ECSP_5357 gi|209396664|ref|YP_002273800.1| gi|253775121|ref|YP_003037952.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]