SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|57865907|ref|YP_190079.1| from Staphylococcus epidermidis RP62A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|57865907|ref|YP_190079.1|
Domain Number 1 Region: 58-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 7.06e-26
Family Ribosomal protein L9 C-domain 0.0000553
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 3.49e-17
Family Ribosomal protein L9 N-domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|57865907|ref|YP_190079.1|
Sequence length 148
Comment 50S ribosomal protein L9 [Staphylococcus epidermidis RP62A]
Sequence
MKVIFTQDVKGKGKKGEVKDVPVGYANNFLLKNKYAVEATPGNLKQLEQQNKRAEADRQQ
EIDDAKALKEQLKDIEVEVSAKTGEGGKLFGSISTKQIAEALKKQHDIKIDKRKMDLPHG
IHALGYTNVPVKLDKEVEGTIRVHTVEQ
Download sequence
Identical sequences A0A0N1MQJ7 A0A0Y2DL91 A0A1U3T606 D4FLR3 Q5HK14 Q8CU90 W1WAG4
NP_763569.1.96214 WP_001831811.1.100050 WP_001831811.1.10021 WP_001831811.1.100433 WP_001831811.1.100549 WP_001831811.1.100800 WP_001831811.1.101221 WP_001831811.1.101292 WP_001831811.1.101732 WP_001831811.1.10200 WP_001831811.1.10516 WP_001831811.1.1064 WP_001831811.1.1066 WP_001831811.1.10880 WP_001831811.1.11039 WP_001831811.1.11097 WP_001831811.1.11264 WP_001831811.1.1172 WP_001831811.1.11988 WP_001831811.1.12195 WP_001831811.1.12254 WP_001831811.1.12399 WP_001831811.1.12601 WP_001831811.1.12633 WP_001831811.1.12940 WP_001831811.1.13547 WP_001831811.1.13713 WP_001831811.1.13993 WP_001831811.1.1487 WP_001831811.1.14999 WP_001831811.1.15050 WP_001831811.1.15264 WP_001831811.1.15608 WP_001831811.1.15634 WP_001831811.1.15776 WP_001831811.1.15796 WP_001831811.1.15975 WP_001831811.1.16031 WP_001831811.1.16425 WP_001831811.1.16888 WP_001831811.1.1734 WP_001831811.1.17536 WP_001831811.1.17589 WP_001831811.1.1780 WP_001831811.1.17932 WP_001831811.1.18322 WP_001831811.1.18738 WP_001831811.1.18820 WP_001831811.1.18924 WP_001831811.1.19169 WP_001831811.1.19525 WP_001831811.1.19634 WP_001831811.1.19747 WP_001831811.1.20605 WP_001831811.1.20829 WP_001831811.1.21138 WP_001831811.1.2143 WP_001831811.1.22029 WP_001831811.1.2266 WP_001831811.1.22744 WP_001831811.1.2308 WP_001831811.1.23129 WP_001831811.1.23748 WP_001831811.1.23933 WP_001831811.1.2398 WP_001831811.1.23999 WP_001831811.1.24537 WP_001831811.1.24864 WP_001831811.1.25104 WP_001831811.1.2587 WP_001831811.1.26079 WP_001831811.1.26136 WP_001831811.1.26728 WP_001831811.1.26763 WP_001831811.1.26887 WP_001831811.1.27014 WP_001831811.1.27020 WP_001831811.1.27021 WP_001831811.1.27243 WP_001831811.1.27273 WP_001831811.1.27634 WP_001831811.1.2771 WP_001831811.1.27842 WP_001831811.1.27875 WP_001831811.1.28189 WP_001831811.1.28279 WP_001831811.1.29015 WP_001831811.1.29043 WP_001831811.1.29412 WP_001831811.1.29900 WP_001831811.1.30044 WP_001831811.1.30228 WP_001831811.1.30361 WP_001831811.1.30590 WP_001831811.1.31449 WP_001831811.1.31487 WP_001831811.1.31837 WP_001831811.1.32007 WP_001831811.1.32060 WP_001831811.1.32657 WP_001831811.1.33089 WP_001831811.1.33508 WP_001831811.1.33701 WP_001831811.1.34082 WP_001831811.1.34374 WP_001831811.1.34705 WP_001831811.1.34758 WP_001831811.1.35206 WP_001831811.1.35778 WP_001831811.1.36104 WP_001831811.1.36293 WP_001831811.1.36528 WP_001831811.1.36840 WP_001831811.1.3698 WP_001831811.1.3735 WP_001831811.1.37506 WP_001831811.1.37572 WP_001831811.1.37668 WP_001831811.1.37755 WP_001831811.1.38090 WP_001831811.1.38123 WP_001831811.1.38364 WP_001831811.1.38568 WP_001831811.1.3910 WP_001831811.1.39158 WP_001831811.1.39520 WP_001831811.1.39993 WP_001831811.1.40006 WP_001831811.1.40194 WP_001831811.1.40309 WP_001831811.1.40408 WP_001831811.1.40535 WP_001831811.1.40661 WP_001831811.1.40934 WP_001831811.1.41570 WP_001831811.1.4163 WP_001831811.1.41640 WP_001831811.1.42083 WP_001831811.1.42133 WP_001831811.1.42501 WP_001831811.1.42781 WP_001831811.1.430 WP_001831811.1.43129 WP_001831811.1.43309 WP_001831811.1.43463 WP_001831811.1.43835 WP_001831811.1.44120 WP_001831811.1.44564 WP_001831811.1.44582 WP_001831811.1.44772 WP_001831811.1.45071 WP_001831811.1.45275 WP_001831811.1.45314 WP_001831811.1.45384 WP_001831811.1.45409 WP_001831811.1.45515 WP_001831811.1.45625 WP_001831811.1.45766 WP_001831811.1.45985 WP_001831811.1.46159 WP_001831811.1.46517 WP_001831811.1.46639 WP_001831811.1.4677 WP_001831811.1.46800 WP_001831811.1.47347 WP_001831811.1.47465 WP_001831811.1.4806 WP_001831811.1.48269 WP_001831811.1.48665 WP_001831811.1.48672 WP_001831811.1.50086 WP_001831811.1.50102 WP_001831811.1.50141 WP_001831811.1.50545 WP_001831811.1.51168 WP_001831811.1.5131 WP_001831811.1.51353 WP_001831811.1.51852 WP_001831811.1.52629 WP_001831811.1.53182 WP_001831811.1.53858 WP_001831811.1.54233 WP_001831811.1.54624 WP_001831811.1.55205 WP_001831811.1.55323 WP_001831811.1.55394 WP_001831811.1.5653 WP_001831811.1.56880 WP_001831811.1.57396 WP_001831811.1.57676 WP_001831811.1.57912 WP_001831811.1.57980 WP_001831811.1.58205 WP_001831811.1.58920 WP_001831811.1.59220 WP_001831811.1.59429 WP_001831811.1.59612 WP_001831811.1.59696 WP_001831811.1.60263 WP_001831811.1.604 WP_001831811.1.60471 WP_001831811.1.60968 WP_001831811.1.61134 WP_001831811.1.62056 WP_001831811.1.62209 WP_001831811.1.62552 WP_001831811.1.63141 WP_001831811.1.63199 WP_001831811.1.63339 WP_001831811.1.63714 WP_001831811.1.64636 WP_001831811.1.65535 WP_001831811.1.65731 WP_001831811.1.65823 WP_001831811.1.66623 WP_001831811.1.66648 WP_001831811.1.66725 WP_001831811.1.67105 WP_001831811.1.67262 WP_001831811.1.67413 WP_001831811.1.67493 WP_001831811.1.68211 WP_001831811.1.68456 WP_001831811.1.68665 WP_001831811.1.687 WP_001831811.1.69187 WP_001831811.1.69281 WP_001831811.1.69584 WP_001831811.1.69585 WP_001831811.1.69743 WP_001831811.1.70385 WP_001831811.1.70534 WP_001831811.1.70703 WP_001831811.1.70714 WP_001831811.1.70755 WP_001831811.1.71072 WP_001831811.1.71096 WP_001831811.1.7127 WP_001831811.1.72059 WP_001831811.1.72202 WP_001831811.1.72358 WP_001831811.1.72549 WP_001831811.1.7287 WP_001831811.1.72908 WP_001831811.1.72948 WP_001831811.1.73003 WP_001831811.1.73271 WP_001831811.1.7393 WP_001831811.1.74694 WP_001831811.1.75068 WP_001831811.1.75166 WP_001831811.1.75383 WP_001831811.1.75578 WP_001831811.1.75757 WP_001831811.1.7577 WP_001831811.1.76151 WP_001831811.1.76766 WP_001831811.1.7796 WP_001831811.1.78204 WP_001831811.1.78266 WP_001831811.1.78514 WP_001831811.1.78749 WP_001831811.1.79009 WP_001831811.1.79087 WP_001831811.1.79415 WP_001831811.1.79856 WP_001831811.1.80118 WP_001831811.1.80285 WP_001831811.1.80311 WP_001831811.1.80313 WP_001831811.1.80534 WP_001831811.1.81223 WP_001831811.1.81326 WP_001831811.1.81614 WP_001831811.1.81804 WP_001831811.1.81818 WP_001831811.1.82021 WP_001831811.1.82163 WP_001831811.1.82199 WP_001831811.1.82273 WP_001831811.1.82303 WP_001831811.1.8237 WP_001831811.1.82807 WP_001831811.1.83976 WP_001831811.1.84232 WP_001831811.1.84248 WP_001831811.1.8443 WP_001831811.1.84545 WP_001831811.1.85164 WP_001831811.1.85372 WP_001831811.1.85545 WP_001831811.1.85735 WP_001831811.1.86219 WP_001831811.1.86391 WP_001831811.1.87036 WP_001831811.1.87531 WP_001831811.1.87968 WP_001831811.1.88153 WP_001831811.1.88436 WP_001831811.1.8850 WP_001831811.1.88657 WP_001831811.1.88681 WP_001831811.1.8890 WP_001831811.1.89058 WP_001831811.1.89239 WP_001831811.1.89313 WP_001831811.1.89535 WP_001831811.1.89842 WP_001831811.1.89877 WP_001831811.1.90286 WP_001831811.1.90573 WP_001831811.1.910 WP_001831811.1.91028 WP_001831811.1.91726 WP_001831811.1.91956 WP_001831811.1.92120 WP_001831811.1.92296 WP_001831811.1.92313 WP_001831811.1.92414 WP_001831811.1.92919 WP_001831811.1.92977 WP_001831811.1.94055 WP_001831811.1.94358 WP_001831811.1.94891 WP_001831811.1.95367 WP_001831811.1.95589 WP_001831811.1.95903 WP_001831811.1.96333 WP_001831811.1.96627 WP_001831811.1.96673 WP_001831811.1.96799 WP_001831811.1.96825 WP_001831811.1.97286 WP_001831811.1.97364 WP_001831811.1.9749 WP_001831811.1.97896 WP_001831811.1.98025 WP_001831811.1.98568 WP_001831811.1.98813 WP_001831811.1.98959 WP_001831811.1.99474 WP_001831811.1.99601 gi|27466932|ref|NP_763569.1| 176279.SERP2538 176280.SE0014 gi|57865907|ref|YP_190079.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]