SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|57866270|ref|YP_187934.1| from Staphylococcus epidermidis RP62A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|57866270|ref|YP_187934.1|
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 2.62e-23
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|57866270|ref|YP_187934.1|
Sequence length 154
Comment hypothetical protein SERP0338 [Staphylococcus epidermidis RP62A]
Sequence
MKYKIEKLDDSSVVYMRMIGTYQSDKNFEMMKTFKHWIQTNHYWKYVEKYGVLGIALDNP
LHVQSNQCRYDVVLRIDETVNDQTISKRDFTGGIYAVFKVSHTKINIEKFFSNLENILNE
SHLRMRNEPIIERYIEEEGTDKVCEMLVPIYEVN
Download sequence
Identical sequences A0A0H2VGM3 A0A0Y1YHQ6 A0A1U3Q441 A0A2G7K4T7 D4FNB1 Q5HR55
gi|57866270|ref|YP_187934.1| gi|27467371|ref|NP_764008.1| NP_764008.1.96214 WP_001832179.1.100549 WP_001832179.1.10200 WP_001832179.1.10516 WP_001832179.1.1066 WP_001832179.1.11264 WP_001832179.1.12633 WP_001832179.1.13547 WP_001832179.1.13993 WP_001832179.1.15608 WP_001832179.1.15634 WP_001832179.1.15776 WP_001832179.1.15796 WP_001832179.1.15975 WP_001832179.1.16031 WP_001832179.1.16425 WP_001832179.1.1734 WP_001832179.1.17589 WP_001832179.1.18738 WP_001832179.1.18820 WP_001832179.1.19525 WP_001832179.1.19634 WP_001832179.1.20222 WP_001832179.1.20605 WP_001832179.1.23748 WP_001832179.1.24864 WP_001832179.1.25359 WP_001832179.1.26079 WP_001832179.1.26136 WP_001832179.1.26728 WP_001832179.1.27021 WP_001832179.1.27273 WP_001832179.1.27875 WP_001832179.1.28279 WP_001832179.1.29043 WP_001832179.1.29900 WP_001832179.1.30228 WP_001832179.1.30361 WP_001832179.1.31837 WP_001832179.1.32657 WP_001832179.1.33508 WP_001832179.1.34082 WP_001832179.1.35778 WP_001832179.1.36528 WP_001832179.1.3698 WP_001832179.1.38123 WP_001832179.1.38296 WP_001832179.1.38568 WP_001832179.1.39158 WP_001832179.1.39993 WP_001832179.1.40194 WP_001832179.1.40309 WP_001832179.1.40661 WP_001832179.1.40934 WP_001832179.1.41570 WP_001832179.1.4163 WP_001832179.1.43129 WP_001832179.1.43309 WP_001832179.1.43463 WP_001832179.1.43835 WP_001832179.1.44564 WP_001832179.1.44772 WP_001832179.1.45071 WP_001832179.1.45275 WP_001832179.1.45384 WP_001832179.1.45401 WP_001832179.1.45409 WP_001832179.1.45625 WP_001832179.1.45985 WP_001832179.1.46580 WP_001832179.1.4677 WP_001832179.1.47347 WP_001832179.1.4806 WP_001832179.1.48269 WP_001832179.1.48672 WP_001832179.1.50086 WP_001832179.1.50102 WP_001832179.1.50545 WP_001832179.1.51852 WP_001832179.1.5653 WP_001832179.1.57676 WP_001832179.1.57980 WP_001832179.1.58205 WP_001832179.1.58920 WP_001832179.1.59220 WP_001832179.1.59429 WP_001832179.1.60968 WP_001832179.1.61490 WP_001832179.1.62056 WP_001832179.1.63141 WP_001832179.1.64636 WP_001832179.1.64836 WP_001832179.1.66623 WP_001832179.1.66851 WP_001832179.1.67262 WP_001832179.1.68211 WP_001832179.1.68456 WP_001832179.1.68665 WP_001832179.1.687 WP_001832179.1.70703 WP_001832179.1.70714 WP_001832179.1.71096 WP_001832179.1.72202 WP_001832179.1.72549 WP_001832179.1.7287 WP_001832179.1.72908 WP_001832179.1.73003 WP_001832179.1.73271 WP_001832179.1.7393 WP_001832179.1.74694 WP_001832179.1.75166 WP_001832179.1.75578 WP_001832179.1.75757 WP_001832179.1.76766 WP_001832179.1.7796 WP_001832179.1.78266 WP_001832179.1.78514 WP_001832179.1.79415 WP_001832179.1.79632 WP_001832179.1.80311 WP_001832179.1.80534 WP_001832179.1.80584 WP_001832179.1.81326 WP_001832179.1.81614 WP_001832179.1.81804 WP_001832179.1.82163 WP_001832179.1.82273 WP_001832179.1.83976 WP_001832179.1.8443 WP_001832179.1.84545 WP_001832179.1.85164 WP_001832179.1.85545 WP_001832179.1.85735 WP_001832179.1.85851 WP_001832179.1.87036 WP_001832179.1.87531 WP_001832179.1.88436 WP_001832179.1.8850 WP_001832179.1.88657 WP_001832179.1.88681 WP_001832179.1.89313 WP_001832179.1.89535 WP_001832179.1.89877 WP_001832179.1.91726 WP_001832179.1.92919 WP_001832179.1.93985 WP_001832179.1.96333 WP_001832179.1.96627 WP_001832179.1.96673 WP_001832179.1.96825 WP_001832179.1.97364 WP_001832179.1.97447 WP_001832179.1.9749 WP_001832179.1.97896 WP_001832179.1.98568 WP_001832179.1.98959 WP_001832179.1.99474 WP_001832179.1.99601 176279.SERP0338 176280.SE0453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]