SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|57867214|ref|YP_188896.1| from Staphylococcus epidermidis RP62A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|57867214|ref|YP_188896.1|
Domain Number 1 Region: 36-299
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.71e-65
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|57867214|ref|YP_188896.1|
Sequence length 333
Comment proline dehydrogenase [Staphylococcus epidermidis RP62A]
Sequence
MSLFKDFFIALSNHTYLNKIAKKMGPQMGANRVVAGNTIHQLIETIQYLNDYNISVTVDS
LGEFVNTREESIKAKEEILEIIDAIYSNNVKAHMSVKISQLGSEFDLNLAYENMREILLK
ADKNGKMHINIDTEKYDSLSKIQHIIDRLKGEFKNVGTVVQAYLYEADDIIDKYPELRLR
LVKGAYKEDASIAFQSKEEIDANYIRIIKKRLLNSKNFTSVATHDNEIINQVKQFMKENH
ISKDKMEFQMLYGFRTELAQKIANEGYFFTVYVPYGNDWFAYFMRRLAERPQNLSLAIKE
FTKPKILKKVTLGIGIFATLLTSLILGIKRHKK
Download sequence
Identical sequences A0A2G7IGK5 Q5HNE5
WP_002485797.1.11039 WP_002485797.1.16425 WP_002485797.1.19525 WP_002485797.1.26728 WP_002485797.1.35778 WP_002485797.1.38568 WP_002485797.1.41570 WP_002485797.1.43129 WP_002485797.1.45985 WP_002485797.1.50102 WP_002485797.1.68211 WP_002485797.1.70703 WP_002485797.1.73003 WP_002485797.1.7796 WP_002485797.1.81326 WP_002485797.1.82273 WP_002485797.1.89313 WP_002485797.1.92120 WP_002485797.1.93985 WP_002485797.1.98959 gi|57867214|ref|YP_188896.1| 176279.SERP1324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]