SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|57865690|ref|YP_189894.1| from Staphylococcus epidermidis RP62A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|57865690|ref|YP_189894.1|
Domain Number 1 Region: 1-319
Classification Level Classification E-value
Superfamily DAK1/DegV-like 8.11e-114
Family DAK1 0.000000643
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|57865690|ref|YP_189894.1|
Sequence length 320
Comment dihydroxyacetone kinase subunit DhaK [Staphylococcus epidermidis RP62A]
Sequence
MKKLIQDKNTILKDMLDGITVSNNDVEVVSDTIVVRKHKKQSGVALVSGGGSGHEPAHAG
FVAEGMLDAAVCGEIFTSPTPDKILDAIKAVDNGDGVLLVIKNYAGDVMNFEMAQEMAQM
EDIKVESVIVRDDIAISDPEKRRGVAGTVFVHKYAGYLAEKGVALDEIKSKVEALLPDIK
SIGMALTPPMVPTTGKNGFDIEDNQMEIGIGIHGEKGLHREDVQPINVIVERLLDQLYKE
IEKKPLIVMVNGMGGTPLSELNIVTKYLDEQFNQNDIDVKQWFVGDYMTALDMQGFSITV
LPFSEELSEALAAPTASKYF
Download sequence
Identical sequences A0A0H2VEK5 A0A2G8GRD3 Q5HKJ9
NP_763791.1.96214 WP_002467644.1.100050 WP_002467644.1.100549 WP_002467644.1.101221 WP_002467644.1.11039 WP_002467644.1.11264 WP_002467644.1.12940 WP_002467644.1.15608 WP_002467644.1.15776 WP_002467644.1.15796 WP_002467644.1.16031 WP_002467644.1.16425 WP_002467644.1.18738 WP_002467644.1.18820 WP_002467644.1.18924 WP_002467644.1.19525 WP_002467644.1.20605 WP_002467644.1.20829 WP_002467644.1.21138 WP_002467644.1.24537 WP_002467644.1.25359 WP_002467644.1.26079 WP_002467644.1.26728 WP_002467644.1.27243 WP_002467644.1.29412 WP_002467644.1.30228 WP_002467644.1.34082 WP_002467644.1.34374 WP_002467644.1.35778 WP_002467644.1.37090 WP_002467644.1.38123 WP_002467644.1.38568 WP_002467644.1.40006 WP_002467644.1.40309 WP_002467644.1.40408 WP_002467644.1.40661 WP_002467644.1.40934 WP_002467644.1.41570 WP_002467644.1.430 WP_002467644.1.43309 WP_002467644.1.43463 WP_002467644.1.44564 WP_002467644.1.45401 WP_002467644.1.45409 WP_002467644.1.45985 WP_002467644.1.46580 WP_002467644.1.47347 WP_002467644.1.48269 WP_002467644.1.48665 WP_002467644.1.50102 WP_002467644.1.50141 WP_002467644.1.5131 WP_002467644.1.53858 WP_002467644.1.54233 WP_002467644.1.54624 WP_002467644.1.55323 WP_002467644.1.5653 WP_002467644.1.57396 WP_002467644.1.57980 WP_002467644.1.58205 WP_002467644.1.59220 WP_002467644.1.59429 WP_002467644.1.61355 WP_002467644.1.63141 WP_002467644.1.64836 WP_002467644.1.66648 WP_002467644.1.66851 WP_002467644.1.67262 WP_002467644.1.68665 WP_002467644.1.69281 WP_002467644.1.69743 WP_002467644.1.70385 WP_002467644.1.70703 WP_002467644.1.70714 WP_002467644.1.70755 WP_002467644.1.7127 WP_002467644.1.72908 WP_002467644.1.72948 WP_002467644.1.73003 WP_002467644.1.75068 WP_002467644.1.7796 WP_002467644.1.78514 WP_002467644.1.80311 WP_002467644.1.81326 WP_002467644.1.82163 WP_002467644.1.82273 WP_002467644.1.82303 WP_002467644.1.8443 WP_002467644.1.84545 WP_002467644.1.87531 WP_002467644.1.87968 WP_002467644.1.88657 WP_002467644.1.88681 WP_002467644.1.89313 WP_002467644.1.89535 WP_002467644.1.89877 WP_002467644.1.90286 WP_002467644.1.92120 WP_002467644.1.92919 WP_002467644.1.93985 WP_002467644.1.94891 WP_002467644.1.96333 WP_002467644.1.96799 WP_002467644.1.97447 WP_002467644.1.98025 WP_002467644.1.98274 WP_002467644.1.98813 WP_002467644.1.98959 WP_002467644.1.99474 WP_002467644.1.99601 gi|57865690|ref|YP_189894.1| gi|27467154|ref|NP_763791.1| 176279.SERP2345 176280.SE0236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]