SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|57867482|ref|YP_189145.1| from Staphylococcus epidermidis RP62A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|57867482|ref|YP_189145.1|
Domain Number 1 Region: 3-133
Classification Level Classification E-value
Superfamily DAK1/DegV-like 4.19e-45
Family DegV-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|57867482|ref|YP_189145.1|
Sequence length 140
Comment hypothetical protein SERP1580 [Staphylococcus epidermidis RP62A]
Sequence
MAKQIIVTDSTSDLSHEYLKQHNIHVIPLSLTIDGKSYTDQVDISSSEYIDHIENDADVK
TSQPPIGRFIETYEQLAQDDVEIISIHLSSGLSGTYNTAVQASHMVDGNITVIDSKSISF
GLGYQIKQIVELVLLQSKKI
Download sequence
Identical sequences A0A0G7I7X9 A0A2I5YYH6 C0X8S7 D2J6L7 J5H4F9 J6B8N3 J6CXL1 J6N1U0 J6PM19 J6R4N9 Q53666 Q5HMP8 Q79CF7
WP_001118605.1.100171 WP_001118605.1.100180 WP_001118605.1.100298 WP_001118605.1.10046 WP_001118605.1.10053 WP_001118605.1.100631 WP_001118605.1.101142 WP_001118605.1.101758 WP_001118605.1.101788 WP_001118605.1.101818 WP_001118605.1.102084 WP_001118605.1.10209 WP_001118605.1.10358 WP_001118605.1.10696 WP_001118605.1.10749 WP_001118605.1.10841 WP_001118605.1.11434 WP_001118605.1.11525 WP_001118605.1.11651 WP_001118605.1.11795 WP_001118605.1.12158 WP_001118605.1.12330 WP_001118605.1.1252 WP_001118605.1.1253 WP_001118605.1.12862 WP_001118605.1.12926 WP_001118605.1.12938 WP_001118605.1.13170 WP_001118605.1.13307 WP_001118605.1.1344 WP_001118605.1.13739 WP_001118605.1.14157 WP_001118605.1.14180 WP_001118605.1.14221 WP_001118605.1.14412 WP_001118605.1.14470 WP_001118605.1.15150 WP_001118605.1.15255 WP_001118605.1.15524 WP_001118605.1.15543 WP_001118605.1.15554 WP_001118605.1.15705 WP_001118605.1.16241 WP_001118605.1.16313 WP_001118605.1.16478 WP_001118605.1.16762 WP_001118605.1.16763 WP_001118605.1.16815 WP_001118605.1.16938 WP_001118605.1.17245 WP_001118605.1.1765 WP_001118605.1.17974 WP_001118605.1.18011 WP_001118605.1.18074 WP_001118605.1.18132 WP_001118605.1.18260 WP_001118605.1.18283 WP_001118605.1.18526 WP_001118605.1.18763 WP_001118605.1.19370 WP_001118605.1.19455 WP_001118605.1.19497 WP_001118605.1.19807 WP_001118605.1.2025 WP_001118605.1.20447 WP_001118605.1.20496 WP_001118605.1.2079 WP_001118605.1.20971 WP_001118605.1.21465 WP_001118605.1.2159 WP_001118605.1.22259 WP_001118605.1.22887 WP_001118605.1.23003 WP_001118605.1.23054 WP_001118605.1.23082 WP_001118605.1.23568 WP_001118605.1.2357 WP_001118605.1.24064 WP_001118605.1.24213 WP_001118605.1.24436 WP_001118605.1.24439 WP_001118605.1.25180 WP_001118605.1.25597 WP_001118605.1.25984 WP_001118605.1.26424 WP_001118605.1.26804 WP_001118605.1.26947 WP_001118605.1.274 WP_001118605.1.27605 WP_001118605.1.28107 WP_001118605.1.28298 WP_001118605.1.28763 WP_001118605.1.2891 WP_001118605.1.29301 WP_001118605.1.29372 WP_001118605.1.29483 WP_001118605.1.29511 WP_001118605.1.30779 WP_001118605.1.30861 WP_001118605.1.31041 WP_001118605.1.31278 WP_001118605.1.31656 WP_001118605.1.3220 WP_001118605.1.32265 WP_001118605.1.32607 WP_001118605.1.33306 WP_001118605.1.3338 WP_001118605.1.3345 WP_001118605.1.33460 WP_001118605.1.33650 WP_001118605.1.33737 WP_001118605.1.33816 WP_001118605.1.34112 WP_001118605.1.34223 WP_001118605.1.34473 WP_001118605.1.34666 WP_001118605.1.35106 WP_001118605.1.35519 WP_001118605.1.35659 WP_001118605.1.35810 WP_001118605.1.35823 WP_001118605.1.36104 WP_001118605.1.3637 WP_001118605.1.36535 WP_001118605.1.36580 WP_001118605.1.36820 WP_001118605.1.36916 WP_001118605.1.37091 WP_001118605.1.37435 WP_001118605.1.37453 WP_001118605.1.38316 WP_001118605.1.39080 WP_001118605.1.39119 WP_001118605.1.3926 WP_001118605.1.39527 WP_001118605.1.39697 WP_001118605.1.39932 WP_001118605.1.4010 WP_001118605.1.40383 WP_001118605.1.40401 WP_001118605.1.40800 WP_001118605.1.4102 WP_001118605.1.41033 WP_001118605.1.41341 WP_001118605.1.41473 WP_001118605.1.41570 WP_001118605.1.42085 WP_001118605.1.4220 WP_001118605.1.42336 WP_001118605.1.42460 WP_001118605.1.42483 WP_001118605.1.43020 WP_001118605.1.43577 WP_001118605.1.43827 WP_001118605.1.44021 WP_001118605.1.44242 WP_001118605.1.44631 WP_001118605.1.44674 WP_001118605.1.44768 WP_001118605.1.452 WP_001118605.1.45275 WP_001118605.1.45610 WP_001118605.1.45874 WP_001118605.1.46050 WP_001118605.1.46056 WP_001118605.1.46348 WP_001118605.1.46514 WP_001118605.1.46815 WP_001118605.1.46965 WP_001118605.1.47187 WP_001118605.1.47276 WP_001118605.1.47308 WP_001118605.1.47408 WP_001118605.1.47560 WP_001118605.1.47617 WP_001118605.1.47667 WP_001118605.1.47792 WP_001118605.1.47821 WP_001118605.1.47856 WP_001118605.1.47989 WP_001118605.1.48017 WP_001118605.1.48116 WP_001118605.1.48951 WP_001118605.1.49079 WP_001118605.1.49131 WP_001118605.1.49577 WP_001118605.1.49704 WP_001118605.1.49934 WP_001118605.1.51226 WP_001118605.1.51741 WP_001118605.1.52436 WP_001118605.1.52664 WP_001118605.1.52772 WP_001118605.1.52904 WP_001118605.1.53007 WP_001118605.1.53077 WP_001118605.1.5319 WP_001118605.1.53191 WP_001118605.1.53372 WP_001118605.1.53835 WP_001118605.1.54161 WP_001118605.1.55352 WP_001118605.1.55620 WP_001118605.1.55728 WP_001118605.1.56159 WP_001118605.1.56200 WP_001118605.1.56241 WP_001118605.1.56525 WP_001118605.1.56641 WP_001118605.1.57048 WP_001118605.1.57136 WP_001118605.1.57324 WP_001118605.1.57542 WP_001118605.1.57770 WP_001118605.1.57840 WP_001118605.1.57844 WP_001118605.1.579 WP_001118605.1.57944 WP_001118605.1.58106 WP_001118605.1.58127 WP_001118605.1.58388 WP_001118605.1.58549 WP_001118605.1.58915 WP_001118605.1.59124 WP_001118605.1.59175 WP_001118605.1.60118 WP_001118605.1.6017 WP_001118605.1.60201 WP_001118605.1.60361 WP_001118605.1.60394 WP_001118605.1.61083 WP_001118605.1.61324 WP_001118605.1.61515 WP_001118605.1.6188 WP_001118605.1.61962 WP_001118605.1.62056 WP_001118605.1.62831 WP_001118605.1.631 WP_001118605.1.63107 WP_001118605.1.63148 WP_001118605.1.63182 WP_001118605.1.63228 WP_001118605.1.63255 WP_001118605.1.63295 WP_001118605.1.63848 WP_001118605.1.63894 WP_001118605.1.63975 WP_001118605.1.63998 WP_001118605.1.64367 WP_001118605.1.64368 WP_001118605.1.64396 WP_001118605.1.64855 WP_001118605.1.64998 WP_001118605.1.65193 WP_001118605.1.65264 WP_001118605.1.65599 WP_001118605.1.65703 WP_001118605.1.65856 WP_001118605.1.65922 WP_001118605.1.66148 WP_001118605.1.66202 WP_001118605.1.66227 WP_001118605.1.66265 WP_001118605.1.66316 WP_001118605.1.66328 WP_001118605.1.66482 WP_001118605.1.66564 WP_001118605.1.66598 WP_001118605.1.66803 WP_001118605.1.67147 WP_001118605.1.67612 WP_001118605.1.67846 WP_001118605.1.67925 WP_001118605.1.68299 WP_001118605.1.68548 WP_001118605.1.68565 WP_001118605.1.68612 WP_001118605.1.68743 WP_001118605.1.68987 WP_001118605.1.69016 WP_001118605.1.69213 WP_001118605.1.69266 WP_001118605.1.69277 WP_001118605.1.69336 WP_001118605.1.69349 WP_001118605.1.69544 WP_001118605.1.69721 WP_001118605.1.706 WP_001118605.1.70924 WP_001118605.1.70939 WP_001118605.1.71179 WP_001118605.1.71404 WP_001118605.1.71547 WP_001118605.1.71910 WP_001118605.1.72058 WP_001118605.1.72067 WP_001118605.1.7292 WP_001118605.1.73121 WP_001118605.1.73190 WP_001118605.1.73246 WP_001118605.1.7326 WP_001118605.1.73265 WP_001118605.1.74627 WP_001118605.1.74758 WP_001118605.1.75132 WP_001118605.1.75680 WP_001118605.1.7602 WP_001118605.1.7627 WP_001118605.1.76295 WP_001118605.1.76825 WP_001118605.1.76876 WP_001118605.1.76944 WP_001118605.1.77328 WP_001118605.1.77553 WP_001118605.1.7827 WP_001118605.1.78503 WP_001118605.1.78749 WP_001118605.1.7930 WP_001118605.1.79402 WP_001118605.1.79407 WP_001118605.1.7992 WP_001118605.1.80104 WP_001118605.1.80181 WP_001118605.1.80210 WP_001118605.1.80318 WP_001118605.1.80345 WP_001118605.1.80452 WP_001118605.1.80556 WP_001118605.1.80972 WP_001118605.1.81049 WP_001118605.1.81176 WP_001118605.1.81214 WP_001118605.1.81290 WP_001118605.1.81327 WP_001118605.1.81575 WP_001118605.1.81905 WP_001118605.1.82017 WP_001118605.1.82026 WP_001118605.1.82058 WP_001118605.1.82349 WP_001118605.1.82467 WP_001118605.1.82993 WP_001118605.1.83314 WP_001118605.1.83490 WP_001118605.1.83992 WP_001118605.1.84025 WP_001118605.1.84161 WP_001118605.1.84260 WP_001118605.1.84269 WP_001118605.1.84416 WP_001118605.1.84696 WP_001118605.1.84874 WP_001118605.1.85547 WP_001118605.1.85611 WP_001118605.1.85825 WP_001118605.1.85834 WP_001118605.1.85858 WP_001118605.1.85971 WP_001118605.1.85980 WP_001118605.1.86086 WP_001118605.1.86197 WP_001118605.1.86531 WP_001118605.1.86968 WP_001118605.1.87110 WP_001118605.1.87221 WP_001118605.1.87261 WP_001118605.1.87579 WP_001118605.1.87682 WP_001118605.1.87912 WP_001118605.1.8820 WP_001118605.1.88395 WP_001118605.1.88436 WP_001118605.1.88987 WP_001118605.1.89290 WP_001118605.1.89537 WP_001118605.1.89715 WP_001118605.1.90370 WP_001118605.1.90454 WP_001118605.1.90488 WP_001118605.1.90503 WP_001118605.1.90562 WP_001118605.1.90804 WP_001118605.1.9122 WP_001118605.1.9130 WP_001118605.1.91624 WP_001118605.1.91639 WP_001118605.1.917 WP_001118605.1.91781 WP_001118605.1.91911 WP_001118605.1.92259 WP_001118605.1.92546 WP_001118605.1.92965 WP_001118605.1.93435 WP_001118605.1.93561 WP_001118605.1.93690 WP_001118605.1.94093 WP_001118605.1.94858 WP_001118605.1.94964 WP_001118605.1.95340 WP_001118605.1.95493 WP_001118605.1.95534 WP_001118605.1.95603 WP_001118605.1.9570 WP_001118605.1.95760 WP_001118605.1.95983 WP_001118605.1.96509 WP_001118605.1.96745 WP_001118605.1.97146 WP_001118605.1.97409 WP_001118605.1.97456 WP_001118605.1.9748 WP_001118605.1.98145 WP_001118605.1.98379 WP_001118605.1.98510 WP_001118605.1.986 WP_001118605.1.98868 WP_001118605.1.99 WP_001118605.1.99090 WP_001118605.1.99183 WP_001118605.1.9925 WP_001118605.1.99432 WP_001118605.1.99494 WP_001118605.1.99845 gi|226464435|ref|YP_002790942.1|NC_012547 gi|33416236|ref|NP_877982.1|NC_005054 gi|410500030|ref|YP_006938355.1|NC_013338 gi|410500239|ref|YP_006938563.1|NC_013343 gi|410500866|ref|YP_006939191.1|NC_013387 gi|410506941|ref|YP_006937653.1|NC_013320 gi|410506996|ref|YP_006937708.1|NC_013321 gi|42761438|ref|NP_976283.1|NC_005566 gi|57867482|ref|YP_189145.1| 176279.SERP1580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]