SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000820 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000000820
Domain Number - Region: 36-133
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000214
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000820   Gene: ENSECAG00000001201   Transcript: ENSECAT00000001021
Sequence length 295
Comment pep:novel chromosome:EquCab2:18:6005699:6006586:1 gene:ENSECAG00000001201 transcript:ENSECAT00000001021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQRNTFQAREHYKTPEKELSETETSDLLDKEFKQNIMRMLTDMQRRMDEHSEHISKEL
EDIKKNQSEMKNIILEMRNSLEGVNSRLEEAEERISELGERLEEVIQAEQKIEKRIRQNE
NSVRELWDNIKRANIIGVPEGEERDKGPENLFVKITEENFPHLRKETDIQVQEAQRAPNK
RSPKRPTPRHIIIKMSKIKDKERILKTARERPQVTYKGKPLRLPADFSAETLQVRREWHN
IFEVLKGKNLQPRILYPSRLSFRMEGEKKSFPDKQKLKEFITKKPVLQGMLKGLI
Download sequence
Identical sequences F7DWI2
ENSECAP00000000820 ENSECAP00000000820 9796.ENSECAP00000000820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]