SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000831 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000831
Domain Number 1 Region: 56-93
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.0000000000000288
Family Ribosomal protein L36 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000831   Gene: ENSECAG00000001222   Transcript: ENSECAT00000001034
Sequence length 93
Comment pep:known_by_projection chromosome:EquCab2:21:56398975:56399256:1 gene:ENSECAG00000001222 transcript:ENSECAT00000001034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPLLRLSSCTGGPRALSTLLLGPLRAALPVEAKPSPAVASLLSSRLAPCLPPALGFKTKG
VIKKRCKDCYRVKRRGRWFIYCKTNPRHKQRQM
Download sequence
Identical sequences F7DW74
9796.ENSECAP00000000831 ENSECAP00000000831 ENSECAP00000000831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]