SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002424 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000002424
Domain Number 1 Region: 10-130
Classification Level Classification E-value
Superfamily dUTPase-like 1.96e-20
Family dUTPase-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002424   Gene: ENSECAG00000003577   Transcript: ENSECAT00000003421
Sequence length 135
Comment pep:novel chromosome:EquCab2:X:44898810:44899214:1 gene:ENSECAG00000003577 transcript:ENSECAT00000003421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YYPSDPLAQFLFSVPATLYSAGLEVLVPKGGMFPPGDTTMIPLNWKLRLPPSHFGLLMFL
NQQANKGVTVLAGVTDPDYQGEIGPQLHNGGEEEHVWNTGDPLRHFLVLPCPVIKVNGKL
QQPDLGRTTNGPDPS
Download sequence
Identical sequences F6XTE8
ENSECAP00000002407 ENSECAP00000002424 ENSECAP00000002407 ENSECAP00000002424 9796.ENSECAP00000002407 9796.ENSECAP00000002424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]