SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003973 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003973
Domain Number 1 Region: 9-119
Classification Level Classification E-value
Superfamily dUTPase-like 4.71e-20
Family dUTPase-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003973   Gene: ENSECAG00000005724   Transcript: ENSECAT00000005629
Sequence length 131
Comment pep:novel chromosome:EquCab2:18:29260153:29260545:-1 gene:ENSECAG00000005724 transcript:ENSECAT00000005629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITPRDPLAKFLLPVLATLCYSGLLVLVPKEGMLPLGDTAMIPLKGKLRLPHGHFGLLMPL
NQQARKGVTVLAGVIDLDYQAEIGLLLPNGSKEEYVWNTGEPLGHLLILPYTVIKVSGKL
KQPNPDRISNG
Download sequence
Identical sequences F7CTP0
9796.ENSECAP00000003973 ENSECAP00000003973 ENSECAP00000003973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]