SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005621 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005621
Domain Number 1 Region: 7-117
Classification Level Classification E-value
Superfamily dUTPase-like 3.27e-16
Family dUTPase-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005621   Gene: ENSECAG00000007645   Transcript: ENSECAT00000007649
Sequence length 133
Comment pep:novel chromosome:EquCab2:5:44736687:44737085:-1 gene:ENSECAG00000007645 transcript:ENSECAT00000007649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITPRDVPSKFLLPVPVTLHSASLEVIVPKGGMLPPGDTMMSLNWKLGLLPGHFGIFMPMN
KQAKKEITVLSGVIDPDYHKEVGLLLHNGSKEEYGWNTGDSREHFLVLPHPVIKVNGKLL
LSSDRTTNGPDPS
Download sequence
Identical sequences F7BZ56
ENSECAP00000005621 ENSECAP00000005621 9796.ENSECAP00000005621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]