SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006256 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006256
Domain Number 1 Region: 36-147
Classification Level Classification E-value
Superfamily Ribosome-binding factor A, RbfA 6.02e-25
Family Ribosome-binding factor A, RbfA 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006256   Gene: ENSECAG00000008292   Transcript: ENSECAT00000008365
Sequence length 254
Comment pep:known_by_projection chromosome:EquCab2:8:93810389:93818799:1 gene:ENSECAG00000008292 transcript:ENSECAT00000008365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKKFWYEGPSLSSHLTYKPSQLEFLTKSTSKKTKKEDHVRLRALNGLLYKALTDLLCTPE
VSQEVYDLNLELSKVSLTSDFSACRVYWKTTLSAEQNSHTEATLRRSAAHVRHLLMSQQT
LRNVPPIVFVQDKENAALAEVDRLLAVADFGPPDENDEFMQNGFREPKALNALSPCNTPG
PAVHSGVFGINHEALNKQIMEYKRRKERGRERLSPEQEAELTKQTKKRKKSKRRMDEDLS
PKDCLWGAVSEDDL
Download sequence
Identical sequences F6TC85
ENSECAP00000006256 9796.ENSECAP00000006256 ENSECAP00000006256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]