SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007578 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007578
Domain Number 1 Region: 141-363
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-57
Family C-terminal domain of adrenodoxin reductase-like 0.00000000395
Further Details:      
 
Domain Number 2 Region: 37-199
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5.06e-19
Family N-terminal domain of adrenodoxin reductase-like 0.00000444
Further Details:      
 
Domain Number 3 Region: 341-491
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000053
Family N-terminal domain of adrenodoxin reductase-like 0.000000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007578   Gene: ENSECAG00000009329   Transcript: ENSECAT00000009888
Sequence length 492
Comment pep:known_by_projection chromosome:EquCab2:11:6980358:6990457:1 gene:ENSECAG00000009329 transcript:ENSECAT00000009888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRCWRWWYWTAWPRTRPPPAGCTLSVRQQFSTQEQTPQICVVGSGPAGFYTAQHLLKH
HPRAHVDIFEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTAHSDRCAFHGNVVVGRDVTV
PELREAYHAVVLSYGAEDHQALGIPGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTA
VILGQGNVALDVARILLTPPEHLEKTDITEAALGVLRQSRVKTVWIVGRRGPLQVAFTIK
ELREMIQLPGTRPILDPADFLGLQDRIKEVPRPRKRLTELLLRTATEKPGAEEAARQASA
SRTWGLRFFRSPQQVLPSPDGRQVAGIRLAVTRLEGVGDTTRAVPTGDVEDLPCGLVLSS
VGYKSRPIDHSVPFDPKLGVIPNMEGRVVDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQ
MLLQDLKAGLLPSGPRPGYVAIEALLSSRGVRPVSFSDWEKLDAEEVSRGQGTGKPREKL
LDPQEMLRLLGR
Download sequence
Identical sequences F6XEM6
9796.ENSECAP00000007578 ENSECAP00000007578 XP_001492665.3.31192 ENSECAP00000007578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]