SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011032 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011032
Domain Number 1 Region: 7-361
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 7.72e-77
Family Glutaminase/Asparaginase 0.00000085
Further Details:      
 
Domain Number 2 Region: 403-552
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-29
Family Ankyrin repeat 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011032   Gene: ENSECAG00000013195   Transcript: ENSECAT00000013858
Sequence length 559
Comment pep:known_by_projection chromosome:EquCab2:24:45478557:45506318:1 gene:ENSECAG00000013195 transcript:ENSECAT00000013858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARATEPERRLLAVYTGGTIGMRSERGVLIPGRGLADVLRTLPMFHDEEHARACDLPEDT
LVLPPASPEQRVIYTVLECQPLFDSSDMTITEWVQIAQIIERHYEQYHGFVVIHGTDTMA
FAASVLSFVLENLQKTVVLTGAQVPIHALWNDGRENLLGALLMGQYVIPEVCLFFQNQLF
RGNRVTKVDARRFAAFCSPNLPPLAIVGPDVTINQELVRKVRGMERLVVHSSMEHDVGLL
RLYPGIPAALVGAYLPALSTPLRLPHPLGKGPAQASLPLCHPAVASPGPLGCAHQHLAQG
GVTSDYAAGMAMAGAGIVSGFDMTSEAALAKLSYVLGQPGLSLEGRKELLARDLRGEMTL
PAVDERRPSLQRSVLGHGVAQLLRQSQGADAVRDTLMPSLACAGARAGDLEALQALVELG
SDLSLEDCSGQTPLHAAARGGHVEVLAMLLQRGVNVNARDQDGLTPLLLAVRGRHQGVIE
LLRAAGACLSPEELEDTGTELCRLASRGDCEGLRAWWQAGADLGRPGYDGRSALLIAEAA
GDLEVVTVLQSLQGGVGAQ
Download sequence
Identical sequences F6ZVE2
ENSECAP00000011032 ENSECAP00000011032 9796.ENSECAP00000011032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]