SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011067 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000011067
Domain Number - Region: 123-173
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00798
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011067   Gene: ENSECAG00000012998   Transcript: ENSECAT00000013903
Sequence length 265
Comment pep:known_by_projection chromosome:EquCab2:5:46752530:46755670:1 gene:ENSECAG00000012998 transcript:ENSECAT00000013903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLSCRRQEDSQVMVYSALRIPPED
Download sequence
Identical sequences F6ZP32
XP_001489214.1.31192 XP_008513116.1.77740 XP_014720892.1.49734 9796.ENSECAP00000011067 ENSECAP00000011067 ENSECAP00000011067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]