SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014344 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014344
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.3e-51
Family Calponin-homology domain, CH-domain 0.00000035
Further Details:      
 
Domain Number 2 Region: 201-262
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 5.36e-18
Family EB1 dimerisation domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014344   Gene: ENSECAG00000016515   Transcript: ENSECAT00000017642
Sequence length 280
Comment pep:novel chromosome:EquCab2:15:69205347:69209208:-1 gene:ENSECAG00000016515 transcript:ENSECAT00000017642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRK
VKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYD
GKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAP
PCILRKNPPSARNGGHETDAQILELNQQLLDLKLTVDGLEKERDFYFSKLRDIELICQEH
ESENSPVISGIIGLYATEEGFAPPEDDEIEEHQQEDQDEY
Download sequence
Identical sequences F6YL75
ENSECAP00000014344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]