SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016285 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016285
Domain Number 1 Region: 153-261,420-491
Classification Level Classification E-value
Superfamily TrmE connector domain 4.71e-38
Family TrmE connector domain 0.0045
Further Details:      
 
Domain Number 2 Region: 35-152
Classification Level Classification E-value
Superfamily Folate-binding domain 3.61e-33
Family TrmE formyl-THF-binding domain 0.00079
Further Details:      
 
Domain Number 3 Region: 257-330
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.01e-19
Family G proteins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016285   Gene: ENSECAG00000018651   Transcript: ENSECAT00000019865
Sequence length 491
Comment pep:known_by_projection chromosome:EquCab2:21:2320846:2324122:1 gene:ENSECAG00000018651 transcript:ENSECAT00000019865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRGLWTLVTRAAHGPRRSCMRQASGAPAPGSGATIFALSSGQGRCGIAVIRTSGPASGH
ALRSLTAPRDVPPPRSACLRLLSDPRTGEPLDRALVLWFPGPQSFTGEDCAEFHVHGGPA
VVSGVLQALGDVPGLRPAEAGEFTRRAFAHGKLSLTEVEGLADLIHAETEAQRRQALRQL
DGELGHLCRSWAETLTKASPLFAGRALAHVEAYIDFGEDDNLEEGVLERADSEVRELEVA
LGAHLRDARRGQRLRSGAHVVVAGPPNAGKSSLVNLLSRKPVSIVSPEPGTTRDVLETPV
DLAGFPALLSDTAGLREGVGPVEQEGVRRARERWAGRLLSSLNHGDSGSPWSSASASPLA
FRPAPRSPSRPIMKNYMPKIGSSRLTQLPDVPPHLLSCLTEEGLDGLEALRKELAEVCGD
PATGPPLLTRARHQHHLQSCLDALGLYKQAKDLALAAEALRVARGHLTRLTGGGGTEEIL
DLIFRDFCVGK
Download sequence
Identical sequences F7BP68
ENSECAP00000016285 9796.ENSECAP00000016285 ENSECAP00000016285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]