SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016646 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016646
Domain Number 1 Region: 32-142
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.58e-37
Family Frataxin-like 0.000000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016646   Gene: ENSECAG00000019174   Transcript: ENSECAT00000020287
Sequence length 155
Comment pep:known_by_projection chromosome:EquCab2:23:21540397:21572688:-1 gene:ENSECAG00000019174 transcript:ENSECAT00000020287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSLHFLSQILNVKKQSVCVMHLRTTGTLGDPGSLDETTYERLAEETLDSLAEFFEDLAD
KPYTFEDYDVSFGSGVLTIKMGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVY
SHDGVSLHELLAAELTKALKTKLDLSSLAYSGKGT
Download sequence
Identical sequences F7B0Q7
ENSECAP00000016646 9796.ENSECAP00000016646 ENSECAP00000016646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]