SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000618 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000618
Domain Number 1 Region: 49-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000553
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 
Domain Number 2 Region: 273-359
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000103
Family I set domains 0.037
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000000618
Domain Number - Region: 172-204
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0615
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000618   Gene: ENSECAG00000000941   Transcript: ENSECAT00000000773
Sequence length 412
Comment pep:novel chromosome:EquCab2:11:18761332:18762567:-1 gene:ENSECAG00000000941 transcript:ENSECAT00000000773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLAHTTVLLWVWGSLQAFEIVEKENIFQRTPCPAFLMFDNAAYLADMSFELPCHCKPEE
VTAVVWYYQKHLGSGHTKVLTDFDGRVLTEEAQVRVGSDMLVRFSIRMFSLLVFRAQPED
SGLYFCGTRKGDYFYAYDVDIQSSEGMVATFKDQGQEPFADEYQGSLHVFTTFWEWTPCD
RCGVRGEQWRIGLCYLQSPDLSPRYRKTLPDVVSCGSRAVPTSLRAKARDHTPELLVQSC
IVPCERKVIQEGMMAIFNYVSKLGSRPWVPQVPIQFHQQRLGHGLIISCPGARPEHAVAW
DKDHQFLYRTQYLKGVNRSMRVFIDHGNHLHIRFTQLSDRGIYYCWRQGVRVAGFRLGVM
SRGHYRASFSDPETRAAMELTLIGYLLITAVFVTIHLCRCCCYLFRCCPNFS
Download sequence
Identical sequences F7D7N4
ENSECAP00000000618 9796.ENSECAP00000000618 ENSECAP00000000618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]