SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001477 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001477
Domain Number 1 Region: 107-217
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.24e-27
Family Canonical RBD 0.0000154
Further Details:      
 
Domain Number 2 Region: 18-105
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.75e-25
Family Canonical RBD 0.00000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001477   Gene: ENSECAG00000000782   Transcript: ENSECAT00000002075
Sequence length 352
Comment pep:known_by_projection chromosome:EquCab2:4:57369340:57374341:-1 gene:ENSECAG00000000782 transcript:ENSECAT00000002075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRS
RGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKE
DTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHN
AEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFG
DGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYN
DFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY
Download sequence
Identical sequences F1LNF1 F6VYB1 G5BD43 G7MLM6 G7P0P7
ENSMMUP00000004838 ENSRNOP00000015152 10116.ENSRNOP00000015152 9544.ENSMMUP00000004838 9796.ENSECAP00000001477 ENSMMUP00000004838 HGL_H00000354021-2 ENSECAP00000001477 ENSECAP00000001477 ENSRNOP00000015152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]