SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002125 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000002125
Domain Number 1 Region: 145-437
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 2.62e-94
Family Cryptochrome/photolyase FAD-binding domain 0.0000125
Further Details:      
 
Domain Number 2 Region: 1-162
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 4.19e-32
Family Cryptochrome/photolyase, N-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002125   Gene: ENSECAG00000000940   Transcript: ENSECAT00000002968
Sequence length 514
Comment pep:known_by_projection chromosome:EquCab2:12:10481174:10495474:1 gene:ENSECAG00000000940 transcript:ENSECAT00000002968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAA
IMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPRKPVGSVTS
QQMESCRADIQENHDETYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVA
NYERPRMNAASLLASPTGLSPYLRFGCLSCRLFYYRLWDLYRKVKRNSTPPLSLFGQLLW
REFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEAKTGFPWIDAIMTQLRQEGW
IHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHC
YCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPEAVQKAAKCIIGVDYPRPIVN
HAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSNPVAEPSSSQAGSVSSAGPRP
PPSGPASPKRKLEAAEEPPGEELSKRARVAEPPS
Download sequence
Identical sequences F6Y7Z4
ENSECAP00000002125 9796.ENSECAP00000002125 ENSECAP00000002125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]