SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006537 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006537
Domain Number 1 Region: 133-262
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.21e-43
Family UAS domain 0.000000201
Further Details:      
 
Domain Number 2 Region: 376-488
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.96e-27
Family UBX domain 0.00000174
Further Details:      
 
Domain Number 3 Region: 13-54
Classification Level Classification E-value
Superfamily UBA-like 0.000000281
Family TAP-C domain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006537   Gene: ENSECAG00000008453   Transcript: ENSECAT00000008694
Sequence length 489
Comment pep:known_by_projection chromosome:EquCab2:19:33246104:33286695:1 gene:ENSECAG00000008453 transcript:ENSECAT00000008694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAHGGSAASSALKGLIQQFTAITGASESVGKHMLEACNNNLEMAVTMFLDGGGIAEEPS
TSSASVSTVRPHTEEEVRAPIPQKQEILVEPEPLFGAPKRRRPARSIFDGFRDFQTETIR
QEQELRNGGAIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFAC
QCLNRDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLV
EWHQLDVSSFLDQVTGFLGEHGQLDGLSSSPPKKCARSESLIDASEDSQLEAAIRASLQE
THFDSTQTKQDSRSDEESESELFSGSEEFISVCGSDEEEEIENLAKSRKSPHKDLGHRKE
ENRRPLTEPPARTEPGTATNHQGLPGVDSEILEISPEKSDGIVEGIDVNGPKAQLMLRYP
DGKREQITLPEQAKLLALVKHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQEAGLCPQ
ETVFVQERN
Download sequence
Identical sequences F6W4A2
ENSECAP00000006537 9796.ENSECAP00000006537 XP_001499653.4.31192 ENSECAP00000006537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]