SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007082 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007082
Domain Number 1 Region: 258-396
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.45e-26
Family UBX domain 0.0095
Further Details:      
 
Domain Number 2 Region: 3-115
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000241
Family Thioltransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007082   Gene: ENSECAG00000008941   Transcript: ENSECAT00000009321
Sequence length 509
Comment pep:known_by_projection chromosome:EquCab2:18:19570829:19605477:1 gene:ENSECAG00000008941 transcript:ENSECAT00000009321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWFQGAIPAAIASAKRSGSVFVVFVAGDDEQSTQMAASWEDEKVREASSNSFVAIKIDT
KSEACLQFSQIYPVVCVPSSFFIGDSGIPLEVIAGSVSADELVTRIHKVQQMHSLKGETS
VANGSQSESSVSTPSTSFEPNNVSENSQSRNVELCETPPTSPDTKSDSATGGECSGLPTP
SQEPSGCSNQRPAEDLTVRVERLTKKLEERREEKRKEEEQREIKKEIERRKTGKEMLDYK
RKQEEELTKRMLEERNREKAEDRAARERIKQQIALDRAERAARFAKTKEEVEAAKAAALL
AKQAEMEVKRDSSARERSTVARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGN
FSLATMFPRREFTKEDYKKKLLDLELAPSASVVLLPAGRPTASMVHSSSGDFWTLLGTVL
YPFLAIWRLISNFLFSSPPPAQTSVRAAALEPSNLGSSSNSEKREPVRKRVLEKRGEDFK
KEGKIYRLRTQDDGEDENNTWNGNSTQQM
Download sequence
Identical sequences F6YDF9
ENSECAP00000007082 ENSECAP00000007082 XP_001489608.2.31192 XP_008515145.1.77740 9796.ENSECAP00000007082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]