SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007687 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007687
Domain Number 1 Region: 2-568
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.49e-83
Family Acetyl-CoA synthetase-like 0.0000391
Further Details:      
 
Domain Number 2 Region: 752-1096
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.57e-46
Family Quinoprotein alcohol dehydrogenase-like 0.008
Further Details:      
 
Domain Number 3 Region: 553-631
Classification Level Classification E-value
Superfamily ACP-like 0.00000406
Family Peptidyl carrier domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007687   Gene: ENSECAG00000009502   Transcript: ENSECAT00000010008
Sequence length 1099
Comment pep:known_by_projection chromosome:EquCab2:3:76379114:76409191:1 gene:ENSECAG00000009502 transcript:ENSECAT00000010008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVHQAASLYSDKIAVCFDECNNQPPVYYTYKTVINAASELSNFLLLHCDFQGIRA
IGLYCHPGINLPSWILGILQVPAAYAPIDPDSPPALSIHFMKKCNLKYILVEKQQINKFK
SSYETLLNYDTFTVEHNDIVLFRLHWKNVEVSLMLNERKEKYEKEKMTNSTSSENSNEEK
SEEHMDARLKHCLAYVLHTSGTTGKPKIVRVPHACIVPNIQHFRVLFEITQDDVLFLASP
LTFDPSVVEIFVALSSGASLLIVPTSVKVIPSKLAAVLFSHHRVTVLQATPTLLRRFGSQ
LIKSTVLSTSTSLRVLALGGEAFPSLTVLKSWRGVGNKTQIFNIYGITEVSSWATFYRIP
EKTLNSTLKCELPVQLGFPLLGTVVEVRDTDGFAIQEGDGQVFLGGRNRVCFLDDEVTVP
LGTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEGLQEVESCAVTWYNQ
EKLILFMVSKNDLVKDYIFEELQKHLPSHAIPDELVLIDSLPFTSHGKIDVSELNKIYLN
YINLKSECKLNGKEELWEKLQHLWKSILSLSEDPLRIPDESLFLNSGGDSLKSIRLLNEI
EKLVGTSVPGLLEIILNSSILEIYNHIVQTVFPDEDLTFSKNYATKRKFSDINQETSGKS
LHQNSVMPLNCDKKINAFIALSRGGQILSVNTTRPLTKLGHCPSACSSDLISQTNTQNVE
SLNPPALSGKSKDPSCVAEFFSEEGTPVIEAEKMELCVRWMSDTGKCVDASPLVVIPAVD
KSSATVYIGSHSHRMMAVDLYSGKVKWEQILGDRVESSACVSKCGNFIVVGCYNGLVYVL
KSSSGEKYWTFTTEDAVKSSATMDPTTGLLYIGSHDQHAYALDIYKKKCVWKLKCGATVF
SSPCLSLTPHHLYFATLGGLLLAVNPATGNRIWKHSCGKPLFSSPRCCLQYICIGCVDGN
LLCFTHFGEQVWQFCTSEPIFSSPCTSASEQEIFFGSHDCFIYCCNTKGHLQWKFETTSR
VYSTPFNFHNYNRSDEMLLAAASTDGKLWILESKSGQLQSVYRLPGEVFSSPVVWESMLI
IGCRNNYVYCLDLLGGNQK
Download sequence
Identical sequences F6YVG5
XP_005608805.1.31192 XP_005608806.1.31192 XP_005608807.1.31192 XP_005608808.1.31192 XP_008510995.1.77740 ENSECAP00000007687 ENSECAP00000007687 9796.ENSECAP00000007687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]