SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007941 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007941
Domain Number 1 Region: 153-419
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.43e-85
Family Eukaryotic proteases 0.0000000135
Further Details:      
 
Domain Number 2 Region: 67-172
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000837
Family Hepsin, N-terminal domain 0.0000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007941   Gene: ENSECAG00000009817   Transcript: ENSECAT00000010305
Sequence length 431
Comment pep:known_by_projection chromosome:EquCab2:10:6227611:6238829:1 gene:ENSECAG00000009817 transcript:ENSECAT00000010305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEEAEAQRGDATCPRPHPTRGGRTVPCCSGPKVAAFTAGTLLLLTGIGAASWAIVTLLLR
SDQEALYPVQVSPADARLTVFDETEGTWRLLCSSRSNARVAGLSCEEMGFLRALEHSELD
VRTAGANGTSGFFCVDEGRLPHARRLLEVISVCDCPRGHFLTALCQDCGHRKLPVDRIVG
GQDTSLGRWPWQVSLRYDGAHLCGGSLLSKDWVLTAAHCFPERNRVLSRWRVFAGAVAQA
SPHGLQLGMQAVVYHGAYLPFRDPSSEENSNDIALVRLSSSLPLTEYIQPVCLPAAQALV
DGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGPDFYGNQIKPKMFCAGYPEGGI
DACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKT
HSEASGMVTQL
Download sequence
Identical sequences F7B8K3
ENSECAP00000007941 ENSECAP00000007941 9796.ENSECAP00000007941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]