SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008896 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008896
Domain Number 1 Region: 29-123
Classification Level Classification E-value
Superfamily Immunoglobulin 9.23e-20
Family I set domains 0.0069
Further Details:      
 
Domain Number 2 Region: 230-292
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000179
Family I set domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008896   Gene: ENSECAG00000011054   Transcript: ENSECAT00000011387
Sequence length 303
Comment pep:novel chromosome:EquCab2:30:28282116:28289760:1 gene:ENSECAG00000011054 transcript:ENSECAT00000011387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGKPFQRSSTPGVSIRQLVEEVPQGCRLPSFDQKPVTLALQEGRNAIFRAVVSGEPRPLV
RWQCSKGSLSNSSKYEISSGPGGREHTLQINKLTGEDTDQYRCTAINMYGEAMCSARLTV
IEVGFRKSRKRVKEPQEDLRKELAEFRKLLKKRAPPAPEKKVDMEQVWQLLMTADRKDYE
RICMKYGIVDFRGMLHKLRQMQKEREHKISQYVNILANLRHIKVSKDGVASFHLELDLKD
LGSKIYLYKDGEMIPYGFDNQTKHCLRHLGKHYHFQIKDLQPEDAGIYQVKVEDTEIFST
ELD
Download sequence
Identical sequences F7CZT3
ENSECAP00000008896 9796.ENSECAP00000008896 ENSECAP00000008896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]