SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009629 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009629
Domain Number 1 Region: 396-789
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.97e-133
Family Ankyrin repeat 0.000000000172
Further Details:      
 
Domain Number 2 Region: 159-414
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.03e-74
Family Ankyrin repeat 0.00000265
Further Details:      
 
Domain Number 3 Region: 9-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.57e-55
Family Ankyrin repeat 0.0000138
Further Details:      
 
Domain Number 4 Region: 1429-1542
Classification Level Classification E-value
Superfamily DEATH domain 1.62e-26
Family DEATH domain, DD 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009629   Gene: ENSECAG00000009700   Transcript: ENSECAT00000012209
Sequence length 1829
Comment pep:known_by_projection chromosome:EquCab2:1:49551464:49778390:-1 gene:ENSECAG00000009700 transcript:ENSECAT00000012209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREA
NVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKF
LLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAA
ALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKR
GNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPL
HMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKAL
NGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS
PNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQL
LQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKL
EVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIA
AKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGL
TPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNA
KTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV
TEETVTTTTITEKHKMNVPETMNEVLDMSDDEVRKANAPEMLSDGEYISDVEEGEDAMTG
DTDKYLGPQDLKELGDDSLPAEGYMGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIE
ELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMR
GSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLG
PVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELG
KKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVG
LQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDT
TPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLA
TQLYRELICVPYMAKFVVFAKMNDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIE
VLEGKPIYVDCYGNLAPLTKGGQQLVFNFYAFKENRLPFSIKIRDTSQEPCGRLSFLKEP
KTTKGLPQTAVCNLNITLPAHKKTEKTDRRQSFASLALRKRYSYLTEPGMSPQSPCERTD
IRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATT
DALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDGYPSLQVELETPT
GLHYTPPTPFQQDDYFSDISSIESPLRTPSRLSDGLVPSQGNIEHSADGPPVVTAEDTSL
EDSKLEDSMPLTEMPEAVDVDESQLENVYLSWQNETSSGNVESPAQARRIIGGLLDRMDD
SPDQCRDSITSYLKGESGKFEANGSHVELTPEAKTKSYFPESQNDVGKQSAKETLKPKIH
GSGRVEEPASSLAAYQKSLEETSKFVIEEPKPCVPVSVKKMSRTSPADGKPRLNLHEEEG
SSGSEQKQGEGYKVKTKKEIRQVEKKSHS
Download sequence
Identical sequences F6ZXD3
ENSECAP00000009629 ENSECAP00000009629 9796.ENSECAP00000009629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]