SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009637 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009637
Domain Number 1 Region: 1-217
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-69
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 
Domain Number 2 Region: 1287-1401
Classification Level Classification E-value
Superfamily E set domains 2.6e-36
Family Filamin repeat (rod domain) 0.0000167
Further Details:      
 
Domain Number 3 Region: 1000-1111
Classification Level Classification E-value
Superfamily E set domains 1e-35
Family Filamin repeat (rod domain) 0.00000229
Further Details:      
 
Domain Number 4 Region: 1477-1595
Classification Level Classification E-value
Superfamily E set domains 4.4e-35
Family Filamin repeat (rod domain) 0.00000286
Further Details:      
 
Domain Number 5 Region: 1401-1510
Classification Level Classification E-value
Superfamily E set domains 8.01e-33
Family Filamin repeat (rod domain) 0.0000206
Further Details:      
 
Domain Number 6 Region: 1808-1903
Classification Level Classification E-value
Superfamily E set domains 7.34e-31
Family Filamin repeat (rod domain) 0.00000326
Further Details:      
 
Domain Number 7 Region: 411-528
Classification Level Classification E-value
Superfamily E set domains 1.2e-30
Family Filamin repeat (rod domain) 0.00068
Further Details:      
 
Domain Number 8 Region: 510-621
Classification Level Classification E-value
Superfamily E set domains 1.4e-30
Family Filamin repeat (rod domain) 0.0000792
Further Details:      
 
Domain Number 9 Region: 1992-2086
Classification Level Classification E-value
Superfamily E set domains 2.19e-30
Family Filamin repeat (rod domain) 0.0000174
Further Details:      
 
Domain Number 10 Region: 1102-1206
Classification Level Classification E-value
Superfamily E set domains 4.2e-30
Family Filamin repeat (rod domain) 0.0000515
Further Details:      
 
Domain Number 11 Region: 1198-1308
Classification Level Classification E-value
Superfamily E set domains 6.67e-30
Family Filamin repeat (rod domain) 0.0000155
Further Details:      
 
Domain Number 12 Region: 627-735
Classification Level Classification E-value
Superfamily E set domains 2.34e-28
Family Filamin repeat (rod domain) 0.00058
Further Details:      
 
Domain Number 13 Region: 723-837
Classification Level Classification E-value
Superfamily E set domains 9.34e-28
Family Filamin repeat (rod domain) 0.00074
Further Details:      
 
Domain Number 14 Region: 815-926
Classification Level Classification E-value
Superfamily E set domains 1.2e-27
Family Filamin repeat (rod domain) 0.00061
Further Details:      
 
Domain Number 15 Region: 2266-2357
Classification Level Classification E-value
Superfamily E set domains 4.67e-27
Family Filamin repeat (rod domain) 0.00000655
Further Details:      
 
Domain Number 16 Region: 233-329
Classification Level Classification E-value
Superfamily E set domains 1.27e-25
Family Filamin repeat (rod domain) 0.0007
Further Details:      
 
Domain Number 17 Region: 1584-1697
Classification Level Classification E-value
Superfamily E set domains 1.47e-25
Family Filamin repeat (rod domain) 0.0000589
Further Details:      
 
Domain Number 18 Region: 333-432
Classification Level Classification E-value
Superfamily E set domains 3.27e-25
Family Filamin repeat (rod domain) 0.00088
Further Details:      
 
Domain Number 19 Region: 2457-2549
Classification Level Classification E-value
Superfamily E set domains 6.67e-25
Family Filamin repeat (rod domain) 0.00000308
Further Details:      
 
Domain Number 20 Region: 2588-2689
Classification Level Classification E-value
Superfamily E set domains 2.2e-24
Family Filamin repeat (rod domain) 0.00000385
Further Details:      
 
Domain Number 21 Region: 2364-2454
Classification Level Classification E-value
Superfamily E set domains 2.47e-23
Family Filamin repeat (rod domain) 0.00000441
Further Details:      
 
Domain Number 22 Region: 913-1014
Classification Level Classification E-value
Superfamily E set domains 2.87e-22
Family Filamin repeat (rod domain) 0.0032
Further Details:      
 
Domain Number 23 Region: 2199-2280
Classification Level Classification E-value
Superfamily E set domains 6.21e-20
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 24 Region: 1911-2006
Classification Level Classification E-value
Superfamily E set domains 6.14e-18
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 25 Region: 1745-1825
Classification Level Classification E-value
Superfamily E set domains 6.54e-16
Family Filamin repeat (rod domain) 0.0000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009637   Gene: ENSECAG00000010052   Transcript: ENSECAT00000012220
Sequence length 2690
Comment pep:known_by_projection chromosome:EquCab2:4:83724050:83752059:1 gene:ENSECAG00000010052 transcript:ENSECAT00000012220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFTRRCNEHLTCVVKRLTDLQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENV
SVALEFLEREHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQT
PKQRLLGWIQNKVPQLPITNFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENARE
AMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIA
YGPGIEPQGNTVLQPAHFTVQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSY
VPKVAGLHKVTVLFAGQNIERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDI
YTAGAGTGDVAVVIVDPQGRRDTVEVALEDKGDSTFRCTYRPVMEGPHTVHVAFAGAPIT
RSPFPVHVAEACNPNACRASGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTE
ELVKVREAGDGVFECEYYPVVPGKYVVTITWGGYAIPRSPFEVQVSPEAGAQKVRAWGPG
LETGQVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAV
HVICDDEDIRDSPFIAHIQPAPPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDASAAGKG
DLKLYAQDADGCPIDINVFTTGNGIFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGE
GSHPEKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFD
IIKNDNDTFTVKYTPPGAGRYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRT
GVEVGKPTHFTVLTKGAGKAKLDVHFAGAGKGEAVRDFEIIDNHDYSYTVKYTAVQQGNM
AVTVTYGGDPVPKSPFVVNVAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLD
VRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFTVEGVLPP
DPSKVCAYGPGLKGGLVGSPAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVS
YLPTEPGEYTINILFAEAHIPGSPFKATIRPVFDPSKVRASGPGLERGKAGEAATFTVDC
SEAGEAELTIEILSDAGVKAEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPT
RVHVQPAIDTSGVKVSGPGVEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKT
DTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDDVAVPKSPFRVGVTEGCDPTRVRAYGPGL
EGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVN
ITFGGRPIPGSPFRVPVKDVVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVA
VLGPTGVAEPVEIRDNGDGTHAVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDAS
KVRASGPGLNAAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTV
SYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQI
GEETVITVDAKAAGKGKVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRF
GGEHIPNSPFHVLACDPMPHVEEPSDVLQLHRPSAYPTHWATEEPVVPVEPMESMLRPFN
LVIPFTVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIP
GDPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITC
KDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVS
LKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTN
SPFKILVGPSEIGDASKVRVWGKGLSEGQTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDI
NCEDMEDGTCKVTYCPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPS
IATIGSTCDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVR
VEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKTEAAEI
VEGEDSAYSVRFVPQEMGPHTVTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLER
GVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIK
FNDEHIPDSPFVVPVASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHT
PSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPG
LVSAYGPGLEGGTTGVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPM
APGNYLIAIKYGGPQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYS
SIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGMLRGRGAASQGTNMMMVGVHGP
KTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVNVP
Download sequence
Identical sequences F6ZWZ3
ENSECAP00000009637 ENSECAP00000009637 9796.ENSECAP00000009637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]