SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010920 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010920
Domain Number 1 Region: 4-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.9e-21
Family Ubiquitin-related 0.0000429
Further Details:      
 
Domain Number 2 Region: 459-506
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000766
Family UBA domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010920   Gene: ENSECAG00000013241   Transcript: ENSECAT00000013732
Sequence length 510
Comment pep:novel chromosome:EquCab2:7:74300914:74302461:-1 gene:ENSECAG00000013241 transcript:ENSECAT00000013732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAREEGGDSQLVSGREPSSHIIRVSVKTPQDCQEFMLAKNSSILHFKKQISKRLHCGA
DRLVLIFTGKILQDQDTLSQRGIFDGTTVHLVVRSQLKRTLPSPGTLPGPTGHCTHRSEP
STSETRLVRLVRSSPDLPDFLGQLAQFLMAAPESAAQFLEDPVFQGLASEKPPNTSHVPE
ASRPVQKSKPALKALENLQNPAQQQVLLQADKRGLEAVKAVPGGNNDMHQVCSDIQQPML
STLAPLVASKCHNLGSEPCKGDANAHSSNDTTAITTASAIARPLTQEVSARVVSQGSTMA
SNQANSGCRPGMSDLCSGQDLPSQDSQQPLGKAALTSQLRPSPLCRALHFLQQNPALIHL
LATGSPLQHHMPVLPILTNPRALQALIQIEKGLQILSREVPGLVPCLWGPGRPHRARGAP
ETRGGGQSHKADPVQPTLVVLQLLHALANACSQSSQLSPSSPLTEGHYQQELEHLKAMGF
VNHDANLQALIATGGDIHAAIERLLGEPEA
Download sequence
Identical sequences F6Q2C7
9796.ENSECAP00000010920 ENSECAP00000010920 ENSECAP00000010920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]