SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011189 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011189
Domain Number 1 Region: 1577-1815,1843-1944
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.92e-89
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000483
Further Details:      
 
Domain Number 2 Region: 862-954
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000216
Family Ubiquitin-related 0.021
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000011189
Domain Number - Region: 804-836,1111-1154,1213-1556,1614-1727
Classification Level Classification E-value
Superfamily ARM repeat 0.000864
Family Clathrin adaptor core protein 0.056
Further Details:      
 
Domain Number - Region: 251-501
Classification Level Classification E-value
Superfamily ARM repeat 0.00792
Family MIF4G domain-like 0.084
Further Details:      
 
Domain Number - Region: 2054-2174,2295-2421
Classification Level Classification E-value
Superfamily ARM repeat 0.0281
Family PBS lyase HEAT-like repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011189   Gene: ENSECAG00000012932   Transcript: ENSECAT00000014040
Sequence length 2515
Comment pep:known_by_projection chromosome:EquCab2:2:4523642:4627538:1 gene:ENSECAG00000012932 transcript:ENSECAT00000014040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKNDENGNCSGEGIEFPTTNLYELESRVLTDHWSIPYKREESLGKCLLASTYLARLGLSE
SDENCKRFMDRCMPEAFKKLLTSSAVHKWGSEIHEGIYNMLMLLVELAAERIKQDPVPVG
LLAVLTMAFNPDNEYHFKNRMKASQRNWAEVFGEGNVFAVSPVSAFQKEPHGWVVDLVNK
FGELGGFAAIQAKLHSEDVELGAVSALVQPLGVCAEYLNASVVQPMLDPVILTTIQDVRS
VEEKDLKDKRLVSIPELLSAIKLLCMRFQPDLVTVVDDLRLDILLRMLKSPHFSAKMNSL
KEVTKLIEDSTLSKSVKNAIDTDRLLDWLVENSVLSIALEGNIDQAQYCDRIKGIIELLG
SKLSLDELTKIWKIQSGQSSTVIENIHTIIAAAAVKFNSDQLNHLFVLIQKSWEAESDRV
RQKLLSLIGRIGREARFETTSGKAIKRIFLATNVLWELAHLPTLPSSLIQQALEEHLTIL
SDAYAVKEAIKRSYIIKCIEDIKRPGEWSGLEKNKKDGVKSSQLNNPQFVWVVPALRQLH
EITRSFIKQTYQKQDKSIIQDLKKNFEIVKLVTGSLIACHRLAAAVAGPGGLTGSTLVDG
RYTYREYLEAHLKFLAFFLQEATLYLGWNRAKEIWECLVTGPDVCELDREMCFEWFTKGQ
HDLESDVQQQLFKEKVLKLESYEITMNGFNLFKTFFENVNLCDHRLKRQGAQLYVEKLEL
IGMDFIWKIAMESPDEEIANEAIQLIINYSYINLNPRLKKDSVSLHKKFIADCYTRLEAA
SSALGGPTLTHAVTRATKMLTATAMPTVATSVQSPYRSTKLVIIERLLLLAERYVITIED
FYSVPRTILPHGASFHGHLLTLNVTYESTKDTFTVEAHSNETIGSVRWKIAKQLCSPVDN
IQIFTNDSLLTVNKDQKLLHQLGFSDEQVLTVKTSGSGTPSGSSADSSTSSSSSSSGVFS
SSYAMEQEKSLPGVVMALVCNVFDMLYQLANLEEPRITLRVRKLLLLIPTDPAIQEALDQ
LDSLGRKKTLLSETSSQSSKSPSLSSKQQHQPSASSILESLFRSFAPGMSTFRVLYNLEV
LSSKLMPTADDDMARNCAKSFCENFLRAGGLSLVVNVMQRDSIPSEVDYETRQGVYSICL
QLARFLLVGQTMPTGKPSQLADSACHAAHNYSSRILTWKTVLFSSFGFPAQSMYKYLKNN
KVLKIYDIHTVYIRYQMRQLNLSYFLDQSVFVSSSFHLTALAVIKRMLEHHPGPVGSTVT
FCLPVPGSTCSSGSEGDAAVLHAGICVRQQSVSTKDSLVAGEALSLLVTCLQLRSQQLAS
FYNLPCVADFIIDILLGSPSAEIRRVACDQLYTLSQTDTSAHPDVQKPNQFLLGVILTAQ
LPLWSPTSIMRGVNQRLLSQCMEYFDLRCQLLDDLTTSEMEQLRISPAAMLEDEITWLDN
FEPNRTADCETSEADNILLAGHLRLIKTLLSLCGAEKEMLGSSLIKPLLDDFLFRASRII
LNSHSPAGSAAISQQDFHPKCSTVNSRLAAYEVLVMLADSSPSNLQIITKELLSMHHQPD
PALTKEFDYLPPVDSRSSSGFVGLRNGGATCYMNAVFQQLYMQPGLPESLLSVDDDTDNP
DDSVFYQVQSLFGHLMESKLQYYVPENFWKIFKMWNKELYVREQQDAYEFFTSLIDQMDE
YLKKMGREQIFKNTFQGIYSDQKICKDCPHRYEREEAFMALNLGVTSCQSLEISLDQFVR
GEVLEGSNAYYCEKCKEKRIAVKRTCIKALPSVLVIHLMRFGFDWESGRSIKYDEQIRFP
WMLNMEPYTVSGMARQDSSSEVGENGRSMDQGGGGSPRKKVALTENYELVGVIVHSGQAH
AGHYYSFIKDRRGCGKGKWYKFNDTVIEEFDLNDETLEYECFGGEYRPKVYDQTNPYTDV
RRRYWNAYMLFYQRVSDQNSPVLPKKSRVSVVRQEAEDLSLSAPSSPEISPQSSPRPLRP
NNDRLSILTKLVKKGEKKGLFVEKMPVRIYQMVRDENLKFMKNRDVYSSDYFSFVLSLAS
LNATKLKHPYYPCMAKVSLQLAIQFLFQTYLRTKKKLRVDTEEWIATIEALLSKSFDACQ
WLVEYFISSEGRELIKIFLLECNVREVRVAVATILEKTLDSALFYQDKLKSLHQLLEVLL
ALLDKDVPENCKNCAQYFFLFNTFVQKQGLRAGDLLLRHSALRHMVRFLLGPARHSSQIR
RWSSAQAREFGNLHNTVALLVLHSDVSSQRNVAPGIFKPRPPVSVAPAGPLLPLHEEVEA
LLFLSEGKPYLLEVMFALRELTGSLLALIEMVVYCCFCNEHFSFSVLHCIKNQLETAPPH
ELKNTFQLLHEILVIEDPIQVERVKFVFETENGLLGNSLMHHSNHVDSSRCYQCVKFLVT
LAQKCPAAKEYFKEHAHHWSWAVQWLQKKMSEHYWTPQSNVSNETSTGKTFQRTISAQDT
LAYATALLNEKEQSGSSNGSESSPANENGERHLQQGSESPMMIGELRSDLDDVDP
Download sequence
Identical sequences F7BCI6
9796.ENSECAP00000011189 ENSECAP00000011189 ENSECAP00000011189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]