SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012717 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012717
Domain Number 1 Region: 204-304
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.87e-27
Family Ras-binding domain, RBD 0.00000307
Further Details:      
 
Domain Number 2 Region: 339-444
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.07e-23
Family FHA domain 0.00000178
Further Details:      
 
Domain Number 3 Region: 940-1037
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-22
Family PDZ domain 0.0000272
Further Details:      
 
Domain Number 4 Region: 1-97
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.24e-21
Family Ras-binding domain, RBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012717   Gene: ENSECAG00000014680   Transcript: ENSECAT00000015784
Sequence length 1601
Comment pep:known_by_projection chromosome:EquCab2:31:8143543:8237215:1 gene:ENSECAG00000014680 transcript:ENSECAT00000015784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGER
RLDVDEKPLVVQLNWNKDDREGRFVLKNENDAFPPKAQSNGPEKQEKEGVIQNFKRTLSK
KEKKEKKKREKEAMRQASDKDDRPFQGDDIENSRLAAEVYKDMPETSFTRTISNPEVVMK
RRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALE
KYGLEKENPQDYCIARVMLPPGAQHSDDKGAKEVILDEDECPLQIFREWPGDKGSLVFQL
KRRPPDYIPKKSKKHGDGKLAKGKERADAASYGSALPPDKLPYLVELSPDGSDSRDKPKL
YRLQLSVTEVGTDKVDDSSIQLFGSGIQPHHCDLTNMDGVVTVTPRSMDAETYVEGQRIS
ETTVLQSGMKVQFGASHVFKFVDPSQDHALAKRSVDGGLTVKGPRHKPGVVQETTFDLGG
DVHSGTALPTSKSATRLDSDRVPSASSTAERGMVKPMVREQQQDYRRQDSRTQDLPGPEL
ILPASIEFRESAEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSSQYRPDVSPTER
THKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVL
AHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGAMSLLRRCRVN
AALTIQLFSQLFHFINMWLFNRLVTDPESGLCSHYWGAIIRQQLGHVEAWAEKQGLELAA
DCHLSRIVQATTLLTMDKYAPEDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPADLI
GSVVAVAENTADELARSDGRQVQLEEDPDLQLPFLLPEDGYSCDVVRNMPNGLQEFLDPL
CQRGFCRLIPHARSPGTWTIYFEGADYESHLMRENTELATPLRKEPEIITVTLKKQNGMG
LSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMT
RTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGKPRPKSEGFELYNNSAQNG
SPESPQLPWAEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKSTYAPGTTAKITS
VSTGNLCTEEQTPPPRPEAYPIPTQTYTREYFTFPASKSQDRMAPPQNQWPSYEEKPHLH
TDSSHSSSAIQRVTRSQEELREEKAYQLERHRIEAVMDHKSDSDMWINQSSSLGSSASSQ
EHLDHSSKAGTPASTLTKSGPGRWKTPAAVPPMPVAVSQPIRTDLPPPPPPPPAHYASEL
DGIPMDLPLPPPPSASHLGPQSAQVAAAERKKREEHQRWYEKEKARLEEERERKRREQER
KLGQMRTQALNPAQFPPAAVQQMKPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYIT
VSREELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQGKPDRTAEENDRLRK
LMLEWQFQKRLQESKQKDEDDEEEEDDDVDTMLIMQRLEAERRARTALPAISVLDLLQDE
ERRRQQQLEEMRKREAEDRARQEEERRQQEEERVRRDAEEK
Download sequence
Identical sequences F7CA85
ENSECAP00000012717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]