SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013049 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013049
Domain Number 1 Region: 397-800
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.25e-135
Family Ankyrin repeat 0.000000000000795
Further Details:      
 
Domain Number 2 Region: 165-415
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.28e-79
Family Ankyrin repeat 0.00000265
Further Details:      
 
Domain Number 3 Region: 5-186
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.46e-44
Family Ankyrin repeat 0.00018
Further Details:      
 
Domain Number 4 Region: 1390-1476
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-22
Family DEATH domain, DD 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013049   Gene: ENSECAG00000013878   Transcript: ENSECAT00000016172
Sequence length 1891
Comment pep:known_by_projection chromosome:EquCab2:27:3610454:3708770:1 gene:ENSECAG00000013878 transcript:ENSECAT00000016172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKE
ISLETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVK
FLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINFGTRGKVRLPALHIAARNDDTRT
AAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASR
RGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSP
IHMAAQGDHLDCVRLLLEYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA
LNGFTPLHIACKKNHMRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKTLLQRGA
SPNVSNVKVETPLHMAARAGHVEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKL
LLENNANPNLATTAGHTPLHTAAREGHVETALALLEKEASQASMTKKGFTPLHVAAKYGK
VQVAKLLLEWAAHPNAAGKNGLTPLHVAVHHNHLDIVKLLLPRGGSPHSPAWNGYTPLHI
AAKQNQMEVARCLLQYGASANAESVQGVTPLHLAAQEGHAEMVALLLSRQANGNLGNKSG
LTPLHLVAQEGHVPVADMLIKRGVKVDATTRMGYTPLHVASHYGNIKLVKFLLQHEANVN
AKTKLGYSPLHQAAQQGHTDIVTLLLKHGASPNEVSSNGTTPLAIATRLGYISVTDVLKV
VTDEPSVVLVSDKHRMSVPETVDEILDVSEDEGEELAGFKAERQDSRDMDEERELVDFVP
KLDQVVESPAIPRIPCVTPETVLIKSEEPEQASKEYDEDSLIPSSPATETSDNISPVASP
VHTGFLVSFMVDARGGSMRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLNTPPPLAEE
EGLASRIIALGPTGAQFLSPVIVEIPHFASHGRGDRELVVLRSENGSVWKEHKDRYGESY
LDQILNGMDEELGSLEELEKKRVCRIITTDFPLYFVIMSRLCQDYDTIGPEGGSLRSKLV
PTVQATFPENAVTKKVKLALQAQPVPDDLVTKLLGNQATFSPIVTVEPRRRKFHRPIGLR
IPLPPSWMDNPRDSGEGDTTSLRLLCSVIGGTEQAQWEDITGTTKLVYANECATFTTNVS
ARFWLSDCPRTAEAVNFATLLYKELTAVPYMAKFVIFAKMNDPREGRLRCYCMTDDKVDK
TLEQHENFVEVARSRDIEVLEGMPLFAELSGNLVPVKKAAQQRSFHFQSFRENRLAIPVK
VRDSSREPGGSLSFLRKAMKYEDTQHILCHLNITMPPCTKGSGADDRRRTLTPLALRYSS
LSESSPGLLSGTDRADMKMAIISEHLGLSWAELARELQFSVEDINRIRVENPNSLLEQSV
ALLNLWVLREGQNAKMENLYAALRSVDRAEIVNMLEGSGRQGRNLKPERRPAERDYSSSP
SQVNGYSSLQDELLSPASLHYALSSPLRADQYWNEVAMIDSNPLVVMDPDAMLEMSDMQV
WSAGLTPSLVTAEDSSLECSKAEDSDATSHEWKLEGSLSKGLQGPTLGSLDLVEDDTVDS
DATNGFTDFLEQKEGQRSEEKLPGHERQEDSTGVRQDSENEVSFVSGQQRVQAHITESPT
VSLVMETSQDRLQDWDGEGSIVSYLQDAAQGSQQEETTQGSHSVQRAVTTVPGLEPHGSQ
EYEKVLGSAPEHLRIEQPEAESPQADRERRRQGHQEWGSQGVTGGNELQNIPGEQVTEEQ
FTDEQGNIVTKKIVRKVVRQIDSSGADDTQEHEEVIAEGPLEDPSELEADIDYFMKHAKV
ELRGSSLQPDLIEGRKGAQIVKRASLKRGKQ
Download sequence
Identical sequences F6UXX6
9796.ENSECAP00000013049 ENSECAP00000013049 ENSECAP00000013049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]