SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013324 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013324
Domain Number 1 Region: 860-1035
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00043
Further Details:      
 
Domain Number 2 Region: 437-552
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.19e-24
Family Pyk2-associated protein beta ARF-GAP domain 0.0029
Further Details:      
 
Domain Number 3 Region: 1119-1266
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-17
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 
Domain Number 4 Region: 550-728
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000074
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 5 Region: 14-62
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000074
Family SAM (sterile alpha motif) domain 0.0049
Further Details:      
 
Domain Number 6 Region: 743-852
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000336
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 7 Region: 1076-1139
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000227
Family Ras-binding domain, RBD 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013324   Gene: ENSECAG00000015544   Transcript: ENSECAT00000016497
Sequence length 1489
Comment pep:known_by_projection chromosome:EquCab2:14:35334664:35353551:1 gene:ENSECAG00000015544 transcript:ENSECAT00000016497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCPQDLDFPVWLATHLEQYADTFRRHGLATAGAARGLGHEELRQLGISATGHRKRILRLL
QAGAAEGSPDPQLDSAMEPSPSTGPQPQLPKPVPKPRTVFGGLSGPTATQRPGLSPALGR
PEVSRSPESSPRSPPLPTSSSEQPSALTTVEMMPNAIYFGLDLRGGAQTAQDMAPDISQT
AAPTPALRPTTGTVHIMDPGCLYYGVQPVGVPGAPDRREGRGVSQDRAEHRLSRQDLEAR
EDAGYASLELPGDSTLSLPTLDTAENSDDLISPYASFSSTADRPTPLLSGWLDKLSPQGW
GCWEGERRERAGKAGSGGGLRSQEPPDLRAPKMQAPPATDLGRLSSRRYVFSERFVRFKR
RGLIYFARIKVGSQEMPHKVALVTPAGMASGIRQVGGVSMPTAWLSTPSFTAESGGARQS
WAAALQEAVTETLSDYEVAEKIWTHRTNRHCADCGASRPDCAAVNLGVVIRQCRSQHRAL
GSGISKVQSLKLDTSVWSNEIVQLFIVLGNDRANRFWAGALPPGEGLHPDTTPGPRGEFI
SRKYRLGLFRKPHPLYPDHSQLLQALCAAVAGPNLLKNMTQLLCVDGEESWSPSALDGSF
PGLLPPDPSPGVYNEVVVPATYSSFLYCGPISNKAGPPPPRRGRDAPPRMWCVLGAALEM
FVSESSPEPLSLIQPQDVVCLGVSPPPADPGDLDRFPFSFELILTGGRIQHFGTDGADSL
EAWISALGKWFSPLSCHQLLGPGLLRLGRLWLRSPSHTALAPGLWLSGFGLLRGDHLFLC
PAPGPGPPAPEDMVHLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGEGRLDFSAWS
TAIEGAAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLA
DFRRDARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEK
YKEVIGCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVR
VLQELIDGYISVFDIDSDQVAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVT
LKVSPTLTAEELTNQVLEMRGTAAGTDLWMTFEILEHGELERPLHPKERVLEQALQWCQL
PEPCSASLLLRKVSLAQAGCLFTGIRRESPRVGLLRCREEPPRLLGNRFQERFFLVRGRC
LLLLKEKKSSKPEREWPLEGAKVYLGIRKKLKPPTPWGFTLILEKMHLYLSCTDEDEMWD
WTTSILKAQHDDQQPVVLRRRSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHN
RRTLSMFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPELTKDTSTSFSTIRERTAKP
ETSLASQRSFDQPLLSKPGTLGQEERPPEPPPGPPSKGSPQAHGSLEEQLLQELSSLILR
KGETTTGPGSPSQPSSPQAPSPNGLATQMPGFPTQPPCPSSPPSSQPLT
Download sequence
Identical sequences F6U0K4
ENSECAP00000013324 ENSECAP00000013324 9796.ENSECAP00000013324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]