SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014415 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014415
Domain Number 1 Region: 191-282
Classification Level Classification E-value
Superfamily TAFH domain-like 2.49e-33
Family TAFH domain-like 0.0000274
Further Details:      
 
Domain Number 2 Region: 592-640
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000115
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014415   Gene: ENSECAG00000016769   Transcript: ENSECAT00000017730
Sequence length 801
Comment pep:known_by_projection chromosome:EquCab2:8:47765030:47896846:1 gene:ENSECAG00000016769 transcript:ENSECAT00000017730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSPLGNPVTKVAPVTSLPKVSSGPRLPAPQIVAVKAPNTTTIQLPANLQLPPGTVLIKSN
SGQLMLVSPQQAVTRAETTSNITSRPAVPVNTQTVKICTMPNSSSQLIKKMAVAPVKKLT
QIATTVVTTVPKPSSVQSVAVPTNVVTVTPVKPLNTVTTLKPSSVGASPAPSNEPSLKAE
NSAAAQTDLSPTMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLVEQLLDGKIEAEE
FTRQLYVELKSSPQPHLVPFLKKSVIALRQLMPNSQSFIQQCVEQTSSEIIIATCTATVT
ASPVVTTTVSSIQPEKPIIVSGATTPRTVSVQTLNPLAGPGAAKTGVVTLHSVGSAAGPG
GATAGTVLLQTPKPLVTSIQNTVTAVSLQPEKPVVSGAAVTLALPSVTFGETSAAAICLP
SVKPVVTSAGTTSDKPVLGAPVQIKLAQPGPILSQPAGIPQAVKVKQLVVQQPSGGIAKQ
VTTLSHSSALTIQKSGQKKMPVNTAIPTSQFPPASILKQITLPGNKILSLQASPVQNNKI
KENGTTSFRNEDDINDVTSMAGVNLNEENACILATNTELVGTLIQSCKDEPFLFIGALQK
RILDIGKKHDITELNSDAVNLISHATQERLRGLLEKLTTIAQHRMTTYKASENYILSSDT
RSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQIQ
QRDANLTALAAIGPRKKRPLESGVEGGLKDNLLASGTSSLTATKQMLRPRITRICLRDLI
FCMEQEKEMKYSRALYLALLK
Download sequence
Identical sequences F6XN65
9796.ENSECAP00000014415 ENSECAP00000014415 ENSECAP00000014415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]